KEGG   Methylocella silvestris: Msil_1196Help
Entry
Msil_1196         CDS       T00802                                 

Definition
(GenBank) Ribulose-bisphosphate carboxylase
  KO
K01602  ribulose-bisphosphate carboxylase small chain [EC:4.1.1.39]
Organism
msl  Methylocella silvestris
Pathway
msl00630  Glyoxylate and dicarboxylate metabolism
msl00710  Carbon fixation in photosynthetic organisms
msl01100  Metabolic pathways
msl01120  Microbial metabolism in diverse environments
msl01200  Carbon metabolism
Module
msl_M00166  Reductive pentose phosphate cycle, ribulose-5P => glyceraldehyde-3P
Brite
KEGG Orthology (KO) [BR:msl00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00630 Glyoxylate and dicarboxylate metabolism
    Msil_1196
  09102 Energy metabolism
   00710 Carbon fixation in photosynthetic organisms
    Msil_1196
Enzymes [BR:msl01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.39  ribulose-bisphosphate carboxylase
     Msil_1196
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: RuBisCO_small
Motif
Other DBs
NCBI-ProteinID: ACK50165
UniProt: B8EPG0
LinkDB All DBs
Position
1283328..1283747
Genome map
AA seq 139 aa AA seqDB search
MRVTQGCFSFLPDLTDDQIRSQVHYCIDKGWAINLEYTDDPHPRNTYWEMWDLPMFDIKD
PAAVMLELDACRKAHAGRYYVRLSGFDASPGWESVRISFIVNRPEKEPGFRLLRTEGPGR
RQIYSLQSYAVDRPESERY
NT seq 420 nt NT seq  +upstreamnt  +downstreamnt
atgcgcgtcacacaggggtgcttttcgttcctgccggacctcaccgacgatcagatccgg
tcacaggtgcattattgcatcgataagggatgggcgatcaatctcgaatacacggacgat
ccgcacccgaggaacacctattgggagatgtgggatctgccgatgttcgacatcaaggac
cccgccgccgtcatgcttgagctcgatgcctgccgcaaggcccatgccgggcgctattat
gtgcggctttcgggtttcgacgcctcgcctggatgggagagcgtgcgcatctccttcatc
gtcaatcgtcctgagaaggagccgggctttcgcctcctgcggaccgaggggcctggtcgc
cggcagatctattcgctgcagtcctatgcggtcgaccggccggaatcggagcgctattga

DBGET integrated database retrieval system