KEGG   Methylocella silvestris: Msil_2318Help
Entry
Msil_2318         CDS       T00802                                 

Definition
(GenBank) 3-dehydroquinate synthase
  KO
K13829  shikimate kinase / 3-dehydroquinate synthase [EC:2.7.1.71 4.2.3.4]
Organism
msl  Methylocella silvestris
Pathway
msl00400  Phenylalanine, tyrosine and tryptophan biosynthesis
msl01100  Metabolic pathways
msl01110  Biosynthesis of secondary metabolites
msl01130  Biosynthesis of antibiotics
msl01230  Biosynthesis of amino acids
Module
msl_M00022  Shikimate pathway, phosphoenolpyruvate + erythrose-4P => chorismate
Brite
KEGG Orthology (KO) [BR:msl00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    Msil_2318
Enzymes [BR:msl01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.71  shikimate kinase
     Msil_2318
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.4  3-dehydroquinate synthase
     Msil_2318
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DHQ_synthase SKI Fe-ADH_2 Fe-ADH AAA_18 AAA_33 Cytidylate_kin2 AAA_16 AAA CoaE AAA_22 AAA_28 TsaE
Motif
Other DBs
NCBI-ProteinID: ACK51249
UniProt: B8EID0
LinkDB All DBs
Position
complement(2510248..2512095)
Genome map
AA seq 615 aa AA seqDB search
MTSSESVKDRPESVTDRRLASLVRSLGDRSIVLVGFMGCGKTSTGRRLAQRLGLPFIDAD
AEIEAAAGMTIAEIFARHGEPSFRDGERRVMARLLEHGPRVIATGGGAFLNEETRARIAR
RGVSVWLKAEPDVLWRRVRKRSHRPLLQSADPEKTLRTLLRERYPYYARADVTVISRDGP
HETAVEEIIAAVEFFMRFSPEPPILAVLDPMNHAAKPPLPPIPSADGEPLFGPAATTAPA
PAAQDAAAVRVELGERSYDILIGAGLIAAAGACVRRLAPGAACAIVTDANVAALHLAELE
RSLREAGVRYSAVIIPPGEQSKSYGVFAKVCDDILAARLERGDLVIALGGGVIGDLAGFA
AASIRRGMRFVQIPTSLLAQVDSSVGGKTGINSEHGKNLIGAFHQPSLVLADADALATLP
LREFRAGYAEIVKYGLIGDAPFFAWLETHWRGVFAGGPDRVHAIATSCRAKAAIVGRDER
ESGERALLNLGHTFGHALERINHYDGERLVHGEAVSVGLALAFRFCARVGLCEGADADRV
EAHLREVGLPTRIADIPGLALDADQMLDAMRQDKKVERGALTFVLARAIGDCFVAKSVEA
AEVRAFLEAELNTGL
NT seq 1848 nt NT seq  +upstreamnt  +downstreamnt
atgaccagctccgaatccgtgaaagacaggccggagagcgtgacggaccgacggctcgcc
tctctcgtccgatcgctcggcgatcgctcgatcgtcctcgtcggcttcatgggctgtggc
aagacctcgaccggccggcgtctcgcgcagcggctcggcttgcctttcatagacgccgac
gccgagatcgaagcggccgccggcatgaccatcgccgagatttttgcaaggcacggcgag
ccttcgttccgtgacggcgagcgccgcgtcatggcccggctgctcgaacacggcccccgc
gtcatcgcaacgggaggcggagcctttctcaatgaggagacacgcgcgcggatcgctcgt
cgcggtgtttcggtctggctgaaggccgaacccgacgtgctgtggcgccgcgtgcgcaag
cgatcgcaccggcccttgttgcaaagcgccgatcccgaaaaaacgctgcgcacgctgttg
cgcgagcgttatccctattatgctcgggccgacgtcaccgtgatttcgcgtgacggcccg
catgagacagcggttgaggaaatcatcgccgcggtcgagtttttcatgcgcttttccccc
gagccgcccatccttgccgtgttggacccgatgaatcacgccgcaaagccgccgctgccg
ccgatcccctccgccgatggcgagcctctcttcggccccgcggccacgaccgcgccggcg
ccggcggcccaggacgccgccgcagtgcgggtcgaactcggcgagcggtcctacgacatt
ctgattggcgcggggcttattgcggcggcgggagcttgcgtgcggcggctggcgcccggc
gccgcctgcgccatcgtcacggacgccaatgtggccgccctgcatcttgccgagctggag
cgctcgctgcgcgaggcgggcgtgcgctatagcgctgtgatcatcccgccgggcgagcag
tccaaatcctatggcgtcttcgccaaggtctgcgacgatattcttgcggcgcggctcgaa
cggggcgatctcgtgatcgcgctcggcggcggcgtcatcggcgatctggcgggctttgcc
gccgcctcgatccggcgcggcatgcgcttcgtgcagatcccgacaagtctgctcgcccag
gtcgattcctccgtcggcggcaagaccgggatcaactccgagcacggcaagaatctgatc
ggcgcctttcatcagccctctctggtgctggccgacgccgacgcgctggccaccctgccg
ctgcgcgaattccgcgccggctacgccgagatcgtgaaatacgggttgatcggcgatgcg
cccttcttcgcctggctcgagactcattggcgcggcgttttcgcgggcggcccggatcgc
gtccacgccatcgcgacgagctgccgcgccaaggcggcgatcgtcggccgcgacgagcgg
gaaagcggggagcgcgcgctgttgaatctcggccacaccttcggccatgcgctggagcgc
atcaaccattacgacggcgagcggctggtgcatggcgaggctgtttcggtcgggctggcg
ctcgccttccgcttctgcgccagagtcgggctctgcgagggcgccgacgcggaccgcgtt
gaggcgcatctgcgcgaggttggcctgccgacgcggatcgccgacatccccggcctcgcg
cttgacgccgatcagatgctcgatgccatgcgccaggacaaaaaggtcgagcgcggcgcc
ctgaccttcgttctggcgcgcgcgatcggcgactgtttcgtcgccaaatcggtcgaggcg
gccgaggtgcgcgctttcctcgaggccgagctcaacacaggactttga

DBGET integrated database retrieval system