KEGG   Methylocella silvestris: Msil_3492Help
Entry
Msil_3492         CDS       T00802                                 

Definition
(GenBank) D-alanine/D-alanine ligase
  KO
K01921  D-alanine-D-alanine ligase [EC:6.3.2.4]
Organism
msl  Methylocella silvestris
Pathway
msl00473  D-Alanine metabolism
msl00550  Peptidoglycan biosynthesis
msl01100  Metabolic pathways
msl01502  Vancomycin resistance
Brite
KEGG Orthology (KO) [BR:msl00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00473 D-Alanine metabolism
    Msil_3492
  09107 Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    Msil_3492
 09160 Human Diseases
  09175 Drug resistance: Antimicrobial
   01502 Vancomycin resistance
    Msil_3492
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:msl01011]
    Msil_3492
Enzymes [BR:msl01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.4  D-alanine---D-alanine ligase
     Msil_3492
Peptidoglycan biosynthesis and degradation proteins [BR:msl01011]
 Precursor biosynthesis
  Amino acid ligase
   Msil_3492
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Dala_Dala_lig_C Dala_Dala_lig_N ATP-grasp_3 GARS_A RimK
Motif
Other DBs
NCBI-ProteinID: ACK52381
UniProt: B8ETM9
LinkDB All DBs
Position
3833085..3834008
Genome map
AA seq 307 aa AA seqDB search
MSKHVAVLMGGLSAEREVSLRSGAACAKALEAEGFRVTTLDVDRDIAQKLAALRPDAALN
ALHGRYGEDGVIQGVLEMLAIPYTHSGVLASALAMQKDRAKDVLRAAGVPVAEGVTIGRF
EAAKAHVMTPPYVVKPLGEGSSFGVIIVRADQTHPPQELTRDDWAYGDLVLVERFVAGRE
LTCAVIGDKAYGVTEIRAADGGWYDYDAKYKAGGSIHILPANLKEFVYQNVQELALVAHR
ALGCRGVSRTDFRYDDTPQGTGELVVLEVNSQPGMTETSLVPEIAAYAGISFGELVRWMV
EDASCDR
NT seq 924 nt NT seq  +upstreamnt  +downstreamnt
atgagcaaacatgtcgccgttctgatgggcggactctcggctgagcgcgaggtttcgctg
cgctcgggcgccgcctgcgccaaggcgctcgaagcggaaggatttagggtcacgacgctc
gacgtcgaccgcgacatcgcgcaaaagctcgcggcgctgcggcccgacgccgccctcaat
gctttgcacggacgctatggcgaagacggcgtgatccagggcgtgcttgaaatgctcgcc
attccttatactcattccggcgtgctcgcctcggcgctcgccatgcagaaggatcgcgcc
aaagatgttctgcgcgccgccggcgtgccggtggccgagggcgtcaccatcgggcgcttc
gaggcggccaaggcgcatgtcatgacgccgccctatgtggtcaagccgctcggcgagggc
tcgtccttcggggtcatcatcgtgcgcgccgatcagacgcatccgccgcaggagctgacg
cgcgacgactgggcctatggcgacctcgttctggtcgaacgcttcgtcgccggacgcgaa
ctgacctgcgccgtcatcggcgacaaggcctatggcgtcaccgaaatccgcgccgcggac
ggcggatggtacgattatgacgcaaaatacaaggctggcggctcgatccacatccttccg
gcaaatcttaaagaatttgtttaccaaaatgtacaagagttagctcttgtggcgcacaga
gcgctcggctgtcgcggggtaagccggactgactttcgctacgacgatacgcctcaaggg
acaggcgagctcgtcgtgctcgaagtcaacagccaacccggaatgaccgagacgtcgctg
gtgccagagatcgcggcatatgccggcatatcttttggtgagcttgttcgatggatggtc
gaagacgcttcctgcgatcgctaa

DBGET integrated database retrieval system