KEGG   Methylocella silvestris: Msil_3764Help
Entry
Msil_3764         CDS       T00802                                 

Definition
(GenBank) NADH ubiquinone oxidoreductase 20 kDa subunit
  KO
K23548  uptake hydrogenase small subunit [EC:1.12.99.6]
Organism
msl  Methylocella silvestris
Pathway
msl00633  Nitrotoluene degradation
msl01120  Microbial metabolism in diverse environments
msl02020  Two-component system
Brite
KEGG Orthology (KO) [BR:msl00001]
 09100 Metabolism
  09111 Xenobiotics biodegradation and metabolism
   00633 Nitrotoluene degradation
    Msil_3764
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    Msil_3764
Enzymes [BR:msl01000]
 1. Oxidoreductases
  1.12  Acting on hydrogen as donor
   1.12.99  With unknown physiological acceptors
    1.12.99.6  hydrogenase (acceptor)
     Msil_3764
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Oxidored_q6 NiFe_hyd_SSU_C
Motif
Other DBs
NCBI-ProteinID: ACK52646
UniProt: B8EJF4
LinkDB All DBs
Position
complement(4119231..4120193)
Genome map
AA seq 320 aa AA seqDB search
MANLLWLQGGACSGNTMSFLNAEEPSACDLVTDFGVNVLWHPSLGMELGDNLKKLLRALT
SGEIALDIFVFEGTVVNAPDGTGEWNRFAGRPMKDWVADLAKVASFTVAIGDCATWGGIP
ATAPNPSESQGLQFLKRAHGGFLGKDYKSKAGLPVINIPGCPAHPDWITQIVVAVATGRG
GDLTLDEFQRPKTFFTSFTQTGCTRNMHFAYKVSATEFGQRKGCLFYDLGCRGPMTHSPC
NRILWNRQSSKTRAGMPCLGCTEPEFPFSELAPGTVFKTQTVMGVPKDMPSGVDKTGYVK
LTAAAKAASPRWAEEDIFVV
NT seq 963 nt NT seq  +upstreamnt  +downstreamnt
atggccaatctgttgtggctccagggcggagcctgttccggcaacacgatgtcgttcctg
aacgcagaggagccgagcgcctgcgacctagtcacggatttcggcgtcaacgtcctgtgg
catccctccctcggcatggagctcggcgacaatctgaagaagctgctgcgggcgctgacc
tcaggcgagatcgcgctcgatatttttgtcttcgaaggcactgtggtcaacgcgccggac
ggcacaggcgaatggaaccgcttcgccggacggcccatgaaggactgggtcgccgacctc
gccaaggtcgcgagctttacggtcgcgatcggcgattgcgcgacatggggcggcattccg
gcgaccgcgcccaatccgtcagagagccagggcctgcaatttctcaagcgcgcccatggc
ggcttcctcggcaaggactataaatccaaggccggtctgccggtcatcaacatccctggc
tgcccggcgcatcccgactggatcacgcagatcgtcgtggcggtcgccaccggccgcggc
ggcgatttgacgctcgacgaatttcagcgtcccaaaactttcttcacctcgttcacccag
accggctgcacgcgcaacatgcatttcgcctacaaggtgtcggcaacggaattcggccag
cgcaagggttgtctcttctacgatctcggctgtcgtggaccgatgacccattcgccgtgc
aatcgcatcctgtggaacaggcaatcgtcgaaaactcgcgccggcatgccgtgccttggc
tgcaccgagccggagttccccttctccgaactcgcgcccggcactgtgttcaagacgcaa
acggtgatgggcgtgccaaaagacatgccgagcggcgtcgacaagaccggctacgtgaag
ctgaccgcggccgccaaggccgcctcgccgcgctgggccgaggaagacatcttcgtcgtc
tga

DBGET integrated database retrieval system