KEGG   Mycobacterium smegmatis MC2 155: MSMEG_1012Help
Entry
MSMEG_1012        CDS       T00434                                 

Definition
(RefSeq) alkaline phosphatase
  KO
K01077  alkaline phosphatase [EC:3.1.3.1]
Organism
msm  Mycobacterium smegmatis MC2 155
Pathway
msm00730  Thiamine metabolism
msm00790  Folate biosynthesis
msm01100  Metabolic pathways
msm02020  Two-component system
Brite
KEGG Orthology (KO) [BR:msm00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00730 Thiamine metabolism
    MSMEG_1012
   00790 Folate biosynthesis
    MSMEG_1012
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    MSMEG_1012
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:msm04147]
    MSMEG_1012
   00537 Glycosylphosphatidylinositol (GPI)-anchored proteins [BR:msm00537]
    MSMEG_1012
Enzymes [BR:msm01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.1  alkaline phosphatase
     MSMEG_1012
Exosome [BR:msm04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   MSMEG_1012
Glycosylphosphatidylinositol (GPI)-anchored proteins [BR:msm00537]
 Enzymes
  MSMEG_1012
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Alk_phosphatase Metalloenzyme Sulfatase
Motif
Other DBs
NCBI-GeneID: 4531950
NCBI-ProteinID: YP_885413
UniProt: A0QR75 I7FF26
LinkDB All DBs
Position
complement(1081451..1082986)
Genome map
AA seq 511 aa AA seqDB search
MPVSTYLRATVVIVAAALLPLTACSSDTTTESSGDTVHRSADGDIVTNGGARRIDGDQTD
TERSAINGGKARNVILLVGDGMGDSEITMARNYEKGAGGSFDGLDALPLSGQYTTYALNK
DGKPNYVTDSAASATGWTTGTKTYNGALGIDIKGNPQKTILELAKAQGFATGDVTTSEIQ
DATSASLFSHISERDCYGPVQTAADCAADALENGGPGSVTEQLLTTRPDLTLGGGAETFS
QTANGGEYKGKTLEAQAKERGFQIVRTASELDAVTAADQDNPVIGLFADGNMPVRWSGPP
AVRHGYLQPAAKCTDNPERGSEVPRLAAMTQKAIDLLKNGKAGQDKGFYLQVEGASIDKK
DHDADPCGQIGETVDFDEAVQTALNFAREDGNTLVVVTADHGHSSQIVEALSEDDLRDIA
EDTKQPVERVRDTMYPGLTRKLVTADDAEMTVSYGTSADVDVESETHTGTQVRVAAFGPR
AANVVGLTDQTDLFFTMTDALGLDRGEEPAH
NT seq 1536 nt NT seq  +upstreamnt  +downstreamnt
gtgcctgtcagtacctatctcagagcgacggtggtgatcgtggcagccgcgctgctgccg
ctcacggcctgcagcagcgacaccaccacggagtccagcggtgacacggtgcaccgctcg
gccgacggcgacatcgtgaccaacggtggcgcgcgccgtatcgacggcgaccagaccgac
accgagcgcagcgcgatcaacggcggcaaggcccgcaatgtcatcctgctggtcggcgac
ggcatgggcgactcggagatcaccatggcccgcaactacgaaaagggcgcaggcggaagc
ttcgacggcctcgacgcgctgccgctgagcgggcagtacaccacctacgcgctcaacaag
gacggtaagcccaactacgtcaccgattcggccgcgagcgccacgggatggaccaccggc
accaagacctacaacggcgcgctgggcatcgacatcaagggcaacccgcagaagacgatc
ctcgaactcgccaaggcacagggtttcgcgaccggtgacgtcaccacgtcggagatccag
gacgccacctcggcgtcgctgttctcccacatcagcgagcgtgactgctacggcccggtc
cagaccgcagccgattgcgcggccgacgccctggagaacggcgggccgggttcggtgacc
gagcagttgctgaccacccgcccggacctgacattgggcggcggcgccgagacgttctcc
cagaccgcgaacggcggcgagtacaagggcaagacgctcgaagcccaggccaaggagcgt
gggttccagatcgtgcgcaccgcaagcgaactcgacgccgtcaccgcggccgatcaggac
aatccggtgatcgggctgttcgccgacggcaacatgccggtgcgctggtcaggcccgccc
gccgtgcgccacggctacctgcagcccgcggccaagtgcaccgacaatcccgagcgcggg
tccgaggtccccaggctggccgcgatgacgcagaaggccatcgatctgttgaagaacgga
aaagccggtcaggacaagggcttctacctgcaggtggaaggcgcgtcgatcgacaagaag
gaccacgacgccgacccgtgcggccagatcggcgagacggtggacttcgacgaggccgtg
cagaccgcgctcaacttcgcccgcgaggacggcaacacgctggtcgtcgtgaccgccgac
cacggtcacagcagccagatcgtggaggccctcagcgaggacgacctgcgcgacatcgcc
gaggacaccaagcagcccgtcgagcgggtccgcgacaccatgtacccgggcctgacccgc
aagctcgtcacggccgatgacgccgagatgacggtcagctacggcacttccgccgatgtc
gacgtcgagagcgagacccacaccggaacccaggtgcgtgtcgcggccttcggtccgagg
gccgcgaacgtcgtcgggctgaccgatcagaccgatctgttcttcaccatgaccgatgcg
ctcggcctcgaccgcggggaggaacccgcgcactga

DBGET integrated database retrieval system