KEGG   Mycobacterium smegmatis MC2 155: MSMEG_1574Help
Entry
MSMEG_1574        CDS       T00434                                 

Definition
(RefSeq) glutamate decarboxylase
  KO
K01580  glutamate decarboxylase [EC:4.1.1.15]
Organism
msm  Mycobacterium smegmatis MC2 155
Pathway
msm00250  Alanine, aspartate and glutamate metabolism
msm00410  beta-Alanine metabolism
msm00430  Taurine and hypotaurine metabolism
msm00650  Butanoate metabolism
msm01100  Metabolic pathways
msm01110  Biosynthesis of secondary metabolites
msm01120  Microbial metabolism in diverse environments
msm02024  Quorum sensing
Module
msm_M00027  GABA (gamma-Aminobutyrate) shunt
Brite
KEGG Orthology (KO) [BR:msm00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00650 Butanoate metabolism
    MSMEG_1574
  09105 Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    MSMEG_1574
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    MSMEG_1574
   00430 Taurine and hypotaurine metabolism
    MSMEG_1574
 09140 Cellular Processes
  09145 Cellular community - prokaryotes
   02024 Quorum sensing
    MSMEG_1574
Enzymes [BR:msm01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.15  glutamate decarboxylase
     MSMEG_1574
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pyridoxal_deC Aminotran_5
Motif
Other DBs
NCBI-GeneID: 4537342
NCBI-ProteinID: YP_885953
UniProt: A0QSR5
LinkDB All DBs
Position
1664273..1665652
Genome map
AA seq 459 aa AA seqDB search
MSHKQSRGPHVAPAYTGRLAMAPVPSLRLPDEAMDPSAAYRFIHDELMLDGSSRLNLATF
VTTWMDPEAEKLMAETFDKNMIDKDEYPATAAIEARCVSMVADLFHAEDLRDDDPASAVG
VSTIGSSEAVMLAGLAMKWRWRAKAGDWKGRTPNLVMGANVQVVWEKFCRYFDVEPRYLP
MAEGRYVITPEQVLDAVDEDTIGVVAILGTTYTGELEPVAEICEALDKLAAGGGVDVPVH
VDAASGGFVVPFIHPDLVWDFRLPRVVSINVSGHKYGLTYPGVGFVVWRNKEHLPEELVF
RVNYLGGDMPTFTLNFSRPGNQVVGQYYNFLRLGRAGYTQVMQCLSQTARWLGDELRDSE
HFELISDGSAIPVVAFRLKGDPGYTEFDISQALRAHGWQVPAYTMPEGAEDVVVLRVVVR
EGFSADLARALKDDIITVLGQLDALKPRGQFDQLQPFAH
NT seq 1380 nt NT seq  +upstreamnt  +downstreamnt
atgtcgcacaagcagagtcgcggtccgcacgtcgcgccggcgtacaccggacggttggcc
atggcgcccgtgccgtcgctgcgcctgcccgacgaggccatggatccgtctgcggcgtac
cggttcatccacgacgagttgatgctcgacggcagctcgcggctgaacctcgcgacgttc
gtgacgacgtggatggaccccgaggccgagaagctcatggccgagacgttcgacaagaac
atgatcgacaaggacgagtacccggccaccgcggccatcgaggcccgctgcgtgtcgatg
gtggccgacctgttccacgccgaggatctgcgcgacgacgacccggcgagcgccgtcggg
gtgtcgacgatcgggtccagcgaggccgtgatgctggccgggctggcgatgaaatggcgc
tggcgcgccaaggccggcgactggaaggggcgcacgccgaacctggtgatgggcgccaac
gtccaggtggtgtgggagaagttctgccgctacttcgacgtcgaaccccgctacctgccg
atggcagagggccgctacgtcatcacgcccgagcaggttctcgacgccgtcgacgaggac
accatcggcgtcgtggcgatcctgggcaccacctacaccggcgagctggaaccggtcgcc
gagatctgcgaggcgctggacaagctcgccgcgggcggcggggtggacgtgccggtgcac
gtcgacgcggccagcggcgggttcgtggtgccgttcatccatcccgacctggtgtgggac
ttccggctgccccgcgtggtgtcgatcaacgtcagcggccacaagtacggcctgacgtac
ccgggtgtcgggttcgtggtgtggcgcaacaaagagcacctgcccgaggagctggtgttc
cgggtcaactacctcggcggcgacatgccgacgttcacgctgaacttctcgcggcccggc
aaccaggtggtggggcagtactacaacttcctgcggctggggcgcgccgggtacacccag
gtgatgcagtgcctgtcgcagaccgcccggtggctgggcgacgagctgcgcgacagcgag
cacttcgagctgatctccgacggttcggccatcccggtcgtggcgttccgtctcaagggc
gatcccggatacaccgagttcgacatctcgcaggcactgcgggcgcacggctggcaggtg
cccgcgtacaccatgcccgagggcgccgaagacgtcgtggtgctgcgtgtggtggtccgt
gaggggttctccgccgacctcgcgcgggcgctcaaggacgacatcatcacggtgctgggc
cagctcgacgcgctcaaaccgcgcgggcagttcgaccagctccagcctttcgcgcattag

DBGET integrated database retrieval system