KEGG   Mycolicibacterium smegmatis MC2 155: MSMEG_2395Help
Entry
MSMEG_2395        CDS       T00434                                 

Gene name
ddl
Definition
(RefSeq) D-alanyl-alanine synthetase A
  KO
K01921  D-alanine-D-alanine ligase [EC:6.3.2.4]
Organism
msm  Mycolicibacterium smegmatis MC2 155
Pathway
msm00473  D-Alanine metabolism
msm00550  Peptidoglycan biosynthesis
msm01100  Metabolic pathways
msm01502  Vancomycin resistance
Brite
KEGG Orthology (KO) [BR:msm00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00473 D-Alanine metabolism
    MSMEG_2395 (ddl)
  09107 Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    MSMEG_2395 (ddl)
 09160 Human Diseases
  09175 Drug resistance: antimicrobial
   01502 Vancomycin resistance
    MSMEG_2395 (ddl)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:msm01011]
    MSMEG_2395 (ddl)
Enzymes [BR:msm01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.4  D-alanine---D-alanine ligase
     MSMEG_2395 (ddl)
Peptidoglycan biosynthesis and degradation proteins [BR:msm01011]
 Precursor biosynthesis
  Amino acid ligase
   MSMEG_2395 (ddl)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Dala_Dala_lig_C Dala_Dala_lig_N ATP-grasp ATP-grasp_3 RimK CPSase_L_D2 ATP-grasp_4 ATPgrasp_ST
Motif
Other DBs
NCBI-GeneID: 4532086
NCBI-ProteinID: YP_886735
UniProt: A0QUZ7
LinkDB All DBs
Position
2478371..2479492
Genome map
AA seq 373 aa AA seqDB search
MTAPNHPPGRTRVAVVYGGRSSEHAISCVSAGSILRNLDPERFEVVAIGITPDGSWVLTD
GRPETLAITDGKLPAVTEASGTELALPAAPNRSGQLLALGNGPGEILAAVDVVFPVLHGP
YGEDGTIQGLLELAGVPYVGSGVLASAAGMDKEYTKKLLAAEGLPIGDQVVLRPGVETLD
LEQRERLGLPVFVKPARGGSSIGVSRVTAWDELPAAVALARRHDPKVIVEAAVIGRELEC
GVLEFPDGRLEASTVGEIRVAGVRGREDGFYDFATKYLEDAAELDVPAKVDDDVADEIRQ
LAVRAFTAIGCQGLARVDFFLTDDGPVINEINTMPGFTTISMYPRMWAAGGIDYPTLLAA
MVDTAIARGTGLR
NT seq 1122 nt NT seq  +upstreamnt  +downstreamnt
gtgactgccccgaaccatcctcctggccgcacccgcgtcgccgtcgtctacggcgggcgt
agctcggagcacgcgatctcgtgcgtgtcggcgggcagcatcctgcgcaacctcgatccg
gagcgtttcgaggtcgtcgccatcggcatcacgcctgacggctcgtgggtgctcaccgac
ggtcggcccgagacgctcgcgatcaccgacggcaaactgcccgcggtgaccgaggcgtcg
ggcaccgaactcgcgctgcccgccgcgcccaaccgcagcggccagttgctggcgctgggc
aacggccccggcgagatcctcgccgcggtcgatgtggtgttccccgtgctgcacggtccg
tacggcgaagacggcaccatccagggcctgctcgaactcgcaggcgtgccctacgtggga
tcgggcgtgctggccagcgccgccggtatggacaaggagtacaccaagaagctgctcgcc
gccgaggggctgccgatcggcgatcaggtggtcctgcgtcccggcgtcgagaccctcgac
ctcgaacagcgtgagcggctcggcctgccggtcttcgtcaaacccgcgcgcggcggatcc
tcgatcggcgtcagccgggtcaccgcgtgggacgaactgcccgcagcggtcgcgctggcg
cgccgccatgacccgaaggtcatcgtcgaggccgcggtgataggccgtgaattggagtgc
ggtgtcctggagttccccgatggccgtctcgaggccagcacggtcggcgagatccgcgtg
gccggtgtgcgcggccgcgaggacgggttctacgacttcgccaccaaatacctcgaggac
gcggccgaactcgacgtgcccgccaaggtcgacgacgacgtcgccgacgagatccggcag
ctcgcggtgcgcgcgttcaccgcgatcggctgccagggcctcgcacgcgtcgacttcttc
ctcaccgacgacggtccggtgatcaacgagatcaacaccatgccggggttcaccaccatc
tcgatgtacccgcggatgtgggccgccggcggtatcgactatccgacgctgctggccgcg
atggtcgacaccgcgatcgcgcggggcaccggcctgcgctga

DBGET integrated database retrieval system