KEGG   Mycolicibacterium smegmatis MC2 155: MSMEG_2487Help
Entry
MSMEG_2487        CDS       T00434                                 

Definition
(RefSeq) 4-aminobutyrate aminotransferase
  KO
K00823  4-aminobutyrate aminotransferase [EC:2.6.1.19]
Organism
msm  Mycolicibacterium smegmatis MC2 155
Pathway
msm00250  Alanine, aspartate and glutamate metabolism
msm00410  beta-Alanine metabolism
msm00640  Propanoate metabolism
msm00650  Butanoate metabolism
msm01100  Metabolic pathways
msm01120  Microbial metabolism in diverse environments
Module
msm_M00027  GABA (gamma-Aminobutyrate) shunt
Brite
KEGG Orthology (KO) [BR:msm00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00640 Propanoate metabolism
    MSMEG_2487
   00650 Butanoate metabolism
    MSMEG_2487
  09105 Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    MSMEG_2487
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    MSMEG_2487
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:msm01007]
    MSMEG_2487
Enzymes [BR:msm01000]
 2. Transferases
  2.6  Transferring nitrogenous groups
   2.6.1  Transaminases
    2.6.1.19  4-aminobutyrate---2-oxoglutarate transaminase
     MSMEG_2487
Amino acid related enzymes [BR:msm01007]
 Aminotransferase (transaminase)
  Class III
   MSMEG_2487
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aminotran_3
Motif
Other DBs
NCBI-GeneID: 4533529
NCBI-ProteinID: YP_886826
UniProt: I7FBL3 A0QV88
LinkDB All DBs
Position
complement(2570219..2571472)
Genome map
AA seq 417 aa AA seqDB search
MTELSQALKQATGVIAARGEGVLLYDEQDRRYLDFTAGIGVTSTGHCHPRVVEAAQRQVG
TLIHGQYTTVMHRPLLTLVERLGEVLPAGLDRMFFANSGSEAIEAALRLSRQATGRPNVI
VFHGGFHGRTVAAASMTTSGTKFRSGFSPLMAGVHVSPFPDPTHFGWPVEQTTDFALSQL
DYVLQTVSAPADTAAFFVEPVLGEGGYVPANERFLAGLRERADAHGILLVLDEVQTGYGR
TGKFWGGEHFDAKPDILVTAKGLASGFPLSGIAASSELMAKAWPGSQGGTYGANAVACAA
AIATLDVIADENLVANAAERGAQLKQALQTVADKHEQITDVRGLGLMIGNEFRDADGKPD
GTTAAAVQQEAARRGLLLLTCGAWGQVVRFIPALVVSADEVEEAAGIWADAVSAVVS
NT seq 1254 nt NT seq  +upstreamnt  +downstreamnt
gtgaccgaactttcgcaggccctcaagcaggcaaccggcgtgatcgccgcccgcggcgag
ggcgtcctgctctacgacgaacaggaccgccgatacctcgatttcaccgcgggtatcggt
gtgacgagcaccggacactgccatccccgggtcgtcgaggccgcgcagcgacaggtgggg
acgctcatccacgggcagtacaccacggtcatgcaccggccactgctcaccctggtggag
cggctcggtgaggtgctcccggccgggctggaccggatgttcttcgccaactccggcagc
gaggccatcgaggccgcgctgcggctcagcaggcaggccaccggccgtcccaacgtcatc
gtcttccacggcggctttcacggcaggaccgtggccgcggcgtcgatgaccacctccggc
accaaattccggtcggggttcagcccactgatggccggcgtgcacgtatcgccgttcccc
gatcccacccacttcggttggcccgtcgaacagaccaccgatttcgcactctcgcaactc
gattacgtgctgcagacggtgagcgcgccggccgacaccgccgcgttcttcgtcgaaccc
gtgctgggcgagggcggttatgttccggccaacgagcgtttcctcgccggactgcgggaa
cgcgccgatgcgcacggcatcctgttggtgctcgacgaggtgcagaccggatacggccgc
acgggaaagttctggggcggcgagcatttcgacgccaaaccggacatcctggtgacggcc
aaaggcctggcgtcgggcttcccgctgtccgggatcgccgcgtcgtcggagttgatggcc
aaggcgtggccggggtcgcagggcggcacctacggggccaacgcggtggcctgcgcggcc
gcgatcgcgaccctcgacgtgatcgcggacgagaacctcgtcgccaatgccgcggagcgc
ggcgcacagctcaagcaggctctgcagacggtcgccgacaagcacgagcagatcaccgac
gtccgcggactcgggttgatgatcggcaacgaattccgcgacgccgacggcaaacccgac
ggcaccaccgcggccgcggtgcagcaggaggcggcccgccgcgggttgctgctgctgacg
tgcggcgcgtggggtcaggtggtgcgcttcatccccgcgctcgtcgtctccgccgatgag
gtggaagaggccgcgggcatctgggccgacgccgtgagcgccgtcgtgtcctga

DBGET integrated database retrieval system