KEGG   Mycolicibacterium smegmatis MC2 155: MSMEG_2630Help
Entry
MSMEG_2630        CDS       T00434                                 

Definition
(RefSeq) DHH family protein
Organism
msm  Mycolicibacterium smegmatis MC2 155
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DHH DHHA1
Motif
Other DBs
NCBI-GeneID: 4531619
NCBI-ProteinID: YP_886967
UniProt: A0QVM9
LinkDB All DBs
Structure
PDB: 

Position
2711052..2712074
Genome map
AA seq 340 aa AA seqDB search
MPVTTTDPKTGLLTGPDAQIAGARVDARGAADLLTAASSVSVICHVYPDADTIGAGLALA
QVLAASGKHVEVSFATPAQLPESLQSLPGGHLLVAPEAMRRDADLVVTVDIPSINRLGAL
SGLAGPGREVLVIDHHASNQLFGTANYIDPSADSTTMLVAELLDAWGKPIDEKVAHCLYA
GLTTDTGSFRWATARAHRLAARLVELGVDNASISRTLLDTHPFAWLPMLSRVLATARLLP
DALDGRGFVYAVVPHDEWSEARPEEVESIVDIVRTTQQAEVAAVFKEIEPMHWSVSMRAK
SVNLASVASAFGGGGHPHAAGYSATGSADDVVQALARALG
NT seq 1023 nt NT seq  +upstreamnt  +downstreamnt
atgccggtgacgacaaccgatcccaagaccggtctgctgaccggtccggacgcccagatc
gccggcgcgcgcgtcgacgcccgtggtgccgctgatctgctgaccgcggcatcgagtgtc
agtgtcatctgccacgtctatccggacgcggacaccatcggcgccgggctcgccctggcg
caggtgctcgccgcatccggcaagcacgtcgaggtgtcgttcgcgacccccgcgcagctg
ccggagtctcttcagtcgctgcccggcgggcatctgctggtcgctccggaggccatgcgg
cgcgacgccgacctggttgtcaccgttgacataccgagcatcaatcggctcggcgcgctc
agtgggctcgccggtcccgggcgtgaggtgctggtcatcgaccatcacgcgtccaaccaa
ctgttcggcaccgccaactacatcgacccttccgcggactcgaccacgatgctcgtggcc
gaactcctcgacgcgtggggcaaacccatcgacgaaaaggtggcccactgcctgtacgcg
gggctgaccaccgacaccgggtcgttccgctgggccacggcgcgtgcccaccggctcgcg
gcccggctggtcgaactcggcgtcgacaacgcgtcgatcagccgcaccctgctcgacacg
catccgttcgcgtggctgccgatgctgtcgcgggttctcgcgacggcccggttgctgccc
gacgcactcgacggccggggcttcgtctacgccgtcgttccgcacgacgagtggtccgag
gcccggccggaagaggtcgagagcatcgtcgacatcgtgcgcaccacgcagcaggccgag
gtcgccgcggtgttcaaggagatcgaaccgatgcactggtcggtctcgatgcgtgccaag
tcggtgaacctggcgtcggtcgccagcgcgttcggcggtggcggtcatccgcacgccgcg
ggatactccgcgaccggttcggccgacgacgtcgtacaggcgctcgcacgggcccttggc
tga

DBGET integrated database retrieval system