KEGG   Mycolicibacterium smegmatis MC2 155: MSMEG_3008Help
Entry
MSMEG_3008        CDS       T00434                                 

Definition
(RefSeq) sigma 54 type regulator
Organism
msm  Mycolicibacterium smegmatis MC2 155
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: HTH_8 HTH_50 GAF Sigma54_activat HTH_23 HTH_30 AAA_16 TIP49 HTH_29 DUF134 H_kinase_N HTH_28 HTH_17 HTH_Tnp_ISL3 HTH_11 TsaE AAA_7 HTH_38
Motif
Other DBs
NCBI-GeneID: 4536692
NCBI-ProteinID: YP_887326
UniProt: A0QWN8
LinkDB All DBs
Position
3076326..3078044
Genome map
AA seq 572 aa AA seqDB search
MSTRRNEARIEDIRAQFLTASEPGRAVPADLLESWVRSKAALGTPANVRDVPQVDEDLLD
NHLVEMFQAPMARVAEDLGGSGMGLLLADAEGRILQRWSQDASAMSHLDRLGTVRGAVLA
EDTVGTNGVGTVIAAGKSVQIAGAEHFADIYRTAVCTGAPVWHPLSGKLLAVVTVSTMLS
ERSGLLVPLTNSVAAQLEQHVLDVAQPGARAMLAAFLESSARHAGPVVAFGPDGLTMRSR
RAGELTQTDVDTINHLCAGLRRDVQVTAELSVGPTVIDVAALDGGAGVVAALRPAPRSSA
AHSIASSSALVGQSKSWRAVAHRVSRHIATREPILVAGELGTGKTSLALGRPFSAGAADT
ATIVHGAERQIVGDQTWLQRVADAVEAGPVVIRGAEHVDGHVLAAVRTLIDGQRGTTPIV
LTMTAALRAEAESAAGRFGVPMVWVPPLRERVSDIGVLWNSFVAQCSPGARLPLADAARQ
ALEAAGWPGNLSDLRGAVDTVLASGKRGTVQVDDLPDTLRSRRTWTLMERTEIEAIRRAL
QEADGNRSKAAELLGVSRATIHRKMKTYHLSG
NT seq 1719 nt NT seq  +upstreamnt  +downstreamnt
gtgtcgacacggcgcaacgaggcccgcatcgaggacatccgtgctcagttcctgacagcg
tccgagccgggccgtgccgtgccggccgatctgctggagtcgtgggtgcggtccaaggca
gccctggggacaccggcgaacgtccgcgacgtgccgcaggtggacgaggatctgctcgac
aaccacctggtggagatgttccaggcgcccatggcgcgggtcgccgaggatctcggtggc
tcgggtatgggcctgctgctggccgacgccgagggtcggatcctgcagcgctggtcgcag
gacgcatcggcgatgagccatctcgaccggctcggcacggtccgcggtgcggtcctggcc
gaggacacggtaggcaccaacggcgtcggcacggtgatcgcggctggcaagagcgtccag
atcgccggtgccgaacacttcgccgacatctaccgcaccgcggtgtgcaccggggcgccg
gtgtggcatccgctttcgggcaaactgctcgcggtggtgacggtgtcgaccatgctcagc
gaacgcagtggcctgctcgtgccgttgaccaactccgttgctgcgcaactcgaacagcat
gtgctcgacgtggcccagccgggcgcccgcgccatgctcgcggcgttcctggagtcctcg
gcccggcacgccggcccggtggtggccttcggccccgacgggctgacgatgcgcagccgc
cgcgccggcgagctcacgcagactgacgtcgacaccatcaaccatctgtgtgcggggctg
cgccgcgatgttcaggtgacggccgagttgtccgtgggcccgacggtcatcgacgtcgcc
gcactcgacggcggcgccggggtggtcgcggcgctgcgtccggccccgagatcgtcggcc
gcgcacagcattgcgtcgtcgtcggcgctggtggggcagtcgaagtcatggcgtgccgtc
gcgcaccgcgtcagcaggcacatcgccacccgcgaaccgattctggtggcgggggagtta
ggcaccggcaagacctcgctcgcgctcggccggccgttctcggccggcgcagcggatacc
gcgacgatcgtgcacggggccgaacggcagatcgtcggcgaccagacctggttgcagcgc
gtggccgacgcggtcgaggcgggcccggtggtgatccgcggggccgagcacgtcgacggc
cacgtcctggccgcggtccggaccctcatcgacgggcagcggggcacgaccccgatcgtg
ctcaccatgacggccgcgctcagggccgaggcggaatcggcggccggccggttcggggtg
cccatggtgtgggtgccgccgctgcgtgaacgtgtgtccgatatcggtgtgttgtggaat
tcctttgtcgcccagtgctcgccgggcgcgcgcctcccgctcgcggacgccgcgcgccag
gcgctggaggccgcggggtggccggggaacctgtcagacctgcgcggtgccgtcgacacc
gtgctggcgtcgggcaagcgcggcacggtgcaggtcgacgacctgcccgacaccctgcgc
agccgtcgcacctggacgctgatggagcgcaccgagatcgaggcgatccggcgggccctt
caggaggcagatggcaaccgatccaaggcggccgaactgctgggcgtgtccagggcgacg
atccaccggaagatgaagacgtaccacctttccggctga

DBGET integrated database retrieval system