KEGG   Mycolicibacterium smegmatis MC2 155: MSMEG_6302Help
Entry
MSMEG_6302        CDS       T00434                                 

Gene name
ligC
Definition
(RefSeq) ATP-dependent DNA ligase
Organism
msm  Mycolicibacterium smegmatis MC2 155
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DNA_ligase_A_M DNA_ligase_A_C
Motif
Other DBs
NCBI-GeneID: 4533888
NCBI-ProteinID: YP_890520
UniProt: A0R5T2
LinkDB All DBs
Position
complement(6368286..6369332)
Genome map
AA seq 348 aa AA seqDB search
MDLPVQPPIEPMLAKAQVKVPDEAGVWSYEPKWDGFRALVFRDGDDVVLQSRNGKDLGRY
FPELLDALRDELVEKCVLDGEVVVPRDIAGRVRLDWESLSQRIHPAASRIKMLAEQTPAH
FIGFDALALGDRSLLKEPFRVRREALAEAVDNKRWCHVTRTSEDPALGTEWLKTFEGAGL
DGVIAKRLDGPYLPGKREMVKVKHHRDADCVAMGYRIHKSGDGIGSILLGLYRDDGELQM
VGGAASFTAKDRIKLLAELEPLREGDEMREGDPSRWNSAADKRWTPLRPEKVCEVAYDQM
EGNSVEGRRFRHAVKFLRWRPDREPSSCTFDQLDTPLNYDLYDVLEEQ
NT seq 1047 nt NT seq  +upstreamnt  +downstreamnt
atggacttgccggtgcagcccccgatcgaaccgatgcttgccaaggcgcaggtgaaggtg
cccgacgaggcgggggtgtggtcctacgagcccaagtgggacggtttccgcgcgctggtg
ttccgcgacggtgacgacgtggtgctgcagtcgcgcaacggcaaggatctgggacggtac
tttcccgaactgctcgacgcgctgcgtgacgaactcgttgagaagtgcgtgctcgacggt
gaggtcgtggtgccccgcgacatcgccggccgggtgcggttggactgggagtcactgagc
cagcgcatccatcccgcggcgagccgcatcaagatgctcgccgagcagaccccggcgcac
ttcatcggcttcgacgccctggccctcggtgaccggtcgctgctcaaggagccgttccgg
gtgcgccgcgaggcgctggccgaggccgtcgacaacaaacggtggtgccacgtcacccgc
accagtgaggatcccgcgctgggcaccgagtggctgaagacgttcgagggcgccgggctg
gacggggtgatcgccaaacggctcgacggaccgtatctgcccggcaaacgtgagatggtc
aaggtcaagcaccaccgcgacgccgactgtgtcgcaatgggttaccgcatccacaagagc
ggcgacggcatcgggtcgatcctgctgggcctgtaccgcgacgacggggagctccagatg
gtcggcggcgcagcgtcgttcaccgccaaggatcgcatcaaactgctggccgaactcgaa
ccgctgcgcgagggcgacgagatgcgtgaaggcgaccccagccggtggaactcggcggcc
gacaagcggtggaccccgctgcgccccgagaaggtgtgcgaggtggcctacgaccagatg
gagggaaactccgtcgagggcaggcgatttcgccacgccgtgaagttcctgcgctggcgt
cccgaccgggagccgtcgagttgcacgttcgaccagttggacaccccgctgaactacgac
ctctacgacgtgctggaggaacagtga

DBGET integrated database retrieval system