KEGG   Mycolicibacterium smegmatis MC2 155: MSMEG_6304Help
Entry
MSMEG_6304        CDS       T00434                                 

Gene name
ligC
Definition
(RefSeq) ATP-dependent DNA ligase
Organism
msm  Mycolicibacterium smegmatis MC2 155
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DNA_ligase_A_M DNA_ligase_A_C
Motif
Other DBs
NCBI-GeneID: 4537064
NCBI-ProteinID: YP_890521
UniProt: A0R5T3
LinkDB All DBs
Position
6369392..6370456
Genome map
AA seq 354 aa AA seqDB search
MDLPVLPPVSPMLSKSVNQIPPGMSYEPKWDGFRSILFRDGAEVELGSRKERPMTRYFPE
LVAAALTELPDRCVIDGEIVLPADNHLDFEALQLRLHPAASRVAMLAEQTPAAFIAFDLL
ALGDDDYTGRPFSERRAALETALADAGPTFHLTPATTDLPTAQRWFHEFEGAGLDGVIAK
PLDLTYQPDKRVMFKVKHQRTADCVVAGYRLHKSGADAVGSLLLGLYDDDGSLASVGVIG
AFPMATRRALFTELQTLVADFDHHPWNWAAQAAADPELARRYGGGSRWNAGKDLSFVPLR
PERLVEVRYDHMEGRRFRHTAQFNRWRPDRDARSCTFAQLDSPPHSSSVTSCRV
NT seq 1065 nt NT seq  +upstreamnt  +downstreamnt
atggacctgcccgtgctgcctccggtgtcgcccatgctgtcgaagtccgtgaaccagatc
ccgccggggatgtcgtatgaacccaagtgggacgggttccggtcgatcctgttccgcgac
ggcgccgaggtggaactcggcagccgcaaggaacggcccatgacccgctactttcctgaa
ttggtggccgcggcgctgaccgagcttcccgaccgctgcgtgatcgacggcgagatcgtc
ctaccggccgacaaccacctcgacttcgaggcgctgcaactgcgtctgcaccccgccgcg
agccgggtggcgatgctcgccgaacagacgcccgcagcgttcatcgcgttcgatctgctg
gcactcggcgacgacgactacaccggccgaccgttcagcgagcgtcgcgccgcgctcgag
accgccctcgcggatgccggcccgacgttccacctgacgcccgccaccaccgatctgccg
actgcgcagcgctggttccacgagttcgaaggcgccggtctcgacggggtcatcgccaaa
cccctggacctgacctaccagccggacaagcgcgtcatgttcaaggtcaagcaccagcgc
accgcggactgcgtggtcgccgggtaccggctgcacaaatccggcgccgacgccgtgggc
tcgctgctgctcgggttgtacgacgacgacggcagcctcgcgtcggtcggcgtcatcggc
gccttcccgatggcgacccggcgggcgctgttcaccgaactgcagacgctggtagccgat
ttcgaccatcacccgtggaactgggccgcgcaggccgcggccgatccggaactcgcccga
cgctacggcggcgggtcacgctggaatgcgggcaaggatctgtcgttcgtcccgcttcgc
cccgaacgcctggtcgaggtgcgctacgaccacatggagggccgccggttccggcacacc
gcgcagttcaaccgctggcgcccggaccgcgacgcgcgttcgtgcacattcgcacagctc
gactccccaccgcattcgagctcggtgacatcgtgccgggtttag

DBGET integrated database retrieval system