KEGG   Mycolicibacterium smegmatis MC2 155: MSMEG_6788Help
Entry
MSMEG_6788        CDS       T00434                                 

Definition
(RefSeq) dihydroxyacetone kinase
  KO
K20901  L-erythrulose 1-kinase [EC:2.7.1.209]
Organism
msm  Mycolicibacterium smegmatis MC2 155
Brite
KEGG Orthology (KO) [BR:msm00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    MSMEG_6788
Enzymes [BR:msm01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.209  L-erythrulose 1-kinase
     MSMEG_6788
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Dak1 Dak2
Motif
Other DBs
NCBI-GeneID: 4535852
NCBI-ProteinID: YP_890996
UniProt: A0R758
LinkDB All DBs
Position
complement(6835256..6836971)
Genome map
AA seq 571 aa AA seqDB search
MTYLLNSPDDFADEAVRGLVAANPDLLTEVPGGVVRSTETPKGQPALVIGGGSGHYPAFA
GWVGPGMGHGAPCGNIFSSPSASEVYSVVRNAENGGGVILGFGNYAGDVLHFGLAAEKLR
HEGIDVRIVTVSDDIASNSPENHRDRRGVAGDLPVFKIAGAAIEAGADLDEAERVAWKAN
DATRSFGLAFEGCTLPGATEPLFHVEKGWMGVGLGIHGEPGVRDNRLGTAAEVADMLFDE
VTAEEPPRGENGYDGRVAVILNGLGTVKYEELFVVYGRIAERLAQQGFTVVRPEVGEFVT
SLDMAGVSLTMVFLDDELERLWTAPVETPAYRRGAMPAVDRTPRTTTWDAAETTIPEASE
GSRECARNIVAVLETFQQVCADNEAELGRIDAVAGDGDHGQGMSFGSRGAAQAARDAVDR
NAGARTTLLLAGQAWADAAGGTSGALWGAALTSAGGVFSDTDGADEQAAVDAICAGIDAI
LRLGGAQPGDKTMVDAAVPFRDALVKAFDTQAGPAITSAARVAREAAEKTADITARRGRA
RVLGEKSVGTPDPGALSFAMLMKALGEHLTR
NT seq 1716 nt NT seq  +upstreamnt  +downstreamnt
atgacgtacctcctgaactctccggacgacttcgccgacgaggcggtgcgcggtctcgtg
gccgccaaccccgatctgctcaccgaggtgcccggcggtgtcgtgcggtccaccgagaca
ccgaagggacaacccgcgctggtgatcggcggcggttcgggccactacccggccttcgca
ggctgggtcggcccaggcatgggccacggcgcgccgtgcggcaacatcttctcctcgccg
tcggcctccgaggtctactcggtggtgcgcaacgccgagaacggcggcggcgtcatcctc
gggttcggcaactacgccggtgacgtcctgcacttcggcctggccgccgagaagctgcgg
cacgagggcatcgacgtgcgcatcgtgaccgtcagtgacgacatcgcctccaacagcccc
gagaaccaccgcgaccgccgcggcgtcgcgggtgacctgccggtgttcaagatcgccggt
gccgcgatcgaagccggtgccgatctcgacgaggccgagcgcgtggcgtggaaggccaac
gacgcgacccgctcgttcggcctggccttcgagggttgcacgctgcccggcgcgaccgaa
ccgctgttccacgtcgaaaaaggctggatgggcgtcggactcggcatccacggtgaaccc
ggcgtccgcgacaaccgcctcggcacggcggccgaggtcgccgacatgctgttcgacgag
gtgaccgccgaggaaccgccgcgcggtgagaacgggtacgacggccgggtggccgtgatt
ctcaacggcctgggcaccgtgaagtacgaagagctgttcgtcgtgtacggccgcatcgcc
gaacgccttgcgcagcaaggattcaccgttgtgcgcccggaggtcggagagttcgtcacc
agcctcgacatggccggtgtgtcgctcaccatggtgttcctcgacgacgaactcgaacgg
ctgtggaccgcacccgtcgagacccccgcctaccgccgcggcgcgatgcctgccgtcgac
cgcacaccacgcaccaccacctgggacgccgcggagaccacgatcccggaggcgagtgag
ggctcgcgcgagtgtgcccgcaacatcgttgccgttcttgagaccttccagcaggtgtgc
gccgacaacgaggccgagctgggccgcatcgacgcggtcgccggcgacggtgaccacggc
cagggcatgtcgttcggttcgcggggcgccgcgcaggccgcgcgtgacgccgtggaccgc
aacgccggcgcccggaccacgctgctgttggccggtcaggcgtgggccgacgcggccggc
ggaacctcgggtgcgctgtggggcgcggcgctgaccagcgccggcggcgtcttcagcgac
accgacggcgcggatgaacaggccgccgtcgacgcgatctgtgccgggatcgatgccatc
ctgcgcctcggtggcgcgcagccgggtgacaagacgatggtcgacgccgccgttcccttc
cgcgatgccctggtgaaggccttcgacacccaggccggaccggcgatcaccagcgccgcc
cgggtggcgcgcgaggccgccgaaaaaactgcggacatcacggctcgacgtggccgcgcg
cgggtactcggggagaagagcgtcggcacgcccgatcccggggccttgtccttcgccatg
ctgatgaaggcgctgggcgagcacctcacccggtga

DBGET integrated database retrieval system