KEGG   Mycolicibacterium smegmatis INHR1: LI99_05015Help
Entry
LI99_05015        CDS       T03409                                 

Definition
(GenBank) alkaline phosphatase
  KO
K01077  alkaline phosphatase [EC:3.1.3.1]
Organism
msn  Mycolicibacterium smegmatis INHR1
Pathway
msn00730  Thiamine metabolism
msn00790  Folate biosynthesis
msn01100  Metabolic pathways
msn02020  Two-component system
Module
msn_M00126  Tetrahydrofolate biosynthesis, GTP => THF
Brite
KEGG Orthology (KO) [BR:msn00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00730 Thiamine metabolism
    LI99_05015
   00790 Folate biosynthesis
    LI99_05015
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    LI99_05015
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:msn04147]
    LI99_05015
   00537 Glycosylphosphatidylinositol (GPI)-anchored proteins [BR:msn00537]
    LI99_05015
Enzymes [BR:msn01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.1  alkaline phosphatase
     LI99_05015
Exosome [BR:msn04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   LI99_05015
Glycosylphosphatidylinositol (GPI)-anchored proteins [BR:msn00537]
 Enzymes
  LI99_05015
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Alk_phosphatase Metalloenzyme Sulfatase
Motif
Other DBs
NCBI-ProteinID: AIU12889
LinkDB All DBs
Position
complement(1081472..1083007)
Genome map
AA seq 511 aa AA seqDB search
MPVSTYLRATVVIVAAALLPLTACSSDTTTESSGDTVHRSADGDIVTNGGARRIDGDQTD
TERSAINGGKARNVILLVGDGMGDSEITMARNYEKGAGGSFDGLDALPLSGQYTTYALNK
DGKPNYVTDSAASATGWTTGTKTYNGALGIDIKGNPQKTILELAKAQGFATGDVTTSEIQ
DATSASLFSHISERDCYGPVQTAADCAADALENGGPGSVTEQLLTTRPDLTLGGGAETFS
QTANGGEYKGKTLEAQAKERGFQIVRTASELDAVTAADQDNPVIGLFADGNMPVRWSGPP
AVRHGYLQPAAKCTDNPERGSEVPRLAAMTQKAIDLLKNGKAGQDKGFYLQVEGASIDKK
DHDADPCGQIGETVDFDEAVQTALNFAREDGNTLVVVTADHGHSSQIVEALSEDDLRDIA
EDTKQPVERVRDTMYPGLTRKLVTADDAEMTVSYGTSADVDVESETHTGTQVRVAAFGPR
AANVVGLTDQTDLFFTMTDALGLDRGEEPAH
NT seq 1536 nt NT seq  +upstreamnt  +downstreamnt
gtgcctgtcagtacctatctcagagcgacggtggtgatcgtggcagccgcgctgctgccg
ctcacggcctgcagcagcgacaccaccacggagtccagcggtgacacggtgcaccgctcg
gccgacggcgacatcgtgaccaacggtggcgcgcgccgtatcgacggcgaccagaccgac
accgagcgcagcgcgatcaacggcggcaaggcccgcaatgtcatcctgctggtcggcgac
ggcatgggcgactcggagatcaccatggcccgcaactacgaaaagggcgcaggcggaagc
ttcgacggcctcgacgcgctgccgctgagcgggcagtacaccacctacgcgctcaacaag
gacggtaagcccaactacgtcaccgattcggccgcgagcgccacgggatggaccaccggc
accaagacctacaacggcgcgctgggcatcgacatcaagggcaacccgcagaagacgatc
ctcgaactcgccaaggcacagggtttcgcgaccggtgacgtcaccacgtcggagatccag
gacgccacctcggcgtcgctgttctcccacatcagcgagcgtgactgctacggcccggtc
cagaccgcagccgattgcgcggccgacgccctggagaacggcgggccgggttcggtgacc
gagcagttgctgaccacccgcccggacctgacattgggcggcggcgccgagacgttctcc
cagaccgcgaacggcggcgagtacaagggcaagacgctcgaagcccaggccaaggagcgt
gggttccagatcgtgcgcaccgcaagcgaactcgacgccgtcaccgcggccgatcaggac
aatccggtgatcgggctgttcgccgacggcaacatgccggtgcgctggtcaggcccgccc
gccgtgcgccacggctacctgcagcccgcggccaagtgcaccgacaatcccgagcgcggg
tccgaggtccccaggctggccgcgatgacgcagaaggccatcgatctgttgaagaacgga
aaagccggtcaggacaagggcttctacctgcaggtggaaggcgcgtcgatcgacaagaag
gaccacgacgccgacccgtgcggccagatcggcgagacggtggacttcgacgaggccgtg
cagaccgcgctcaacttcgcccgcgaggacggcaacacgctggtcgtcgtgaccgccgac
cacggtcacagcagccagatcgtggaggccctcagcgaggacgacctgcgcgacatcgcc
gaggacaccaagcagcccgtcgagcgggtccgcgacaccatgtacccgggcctgacccgc
aagctcgtcacggccgatgacgccgagatgacggtcagctacggcacttccgccgatgtc
gacgtcgagagcgagacccacaccggaacccaggtgcgtgtcgcggccttcggtccgagg
gccgcgaacgtcgtcgggctgaccgatcagaccgatctgttcttcaccatgaccgatgcg
ctcggcctcgaccgcggggaggaacccgcgcactga

DBGET integrated database retrieval system