KEGG   Mycobacterium smegmatis INHR1: LI99_07865Help
Entry
LI99_07865        CDS       T03409                                 

Definition
(GenBank) alanine racemase
  KO
K01775  alanine racemase [EC:5.1.1.1]
Organism
msn  Mycobacterium smegmatis INHR1
Pathway
msn00473  D-Alanine metabolism
msn01100  Metabolic pathways
msn01502  Vancomycin resistance
Brite
KEGG Orthology (KO) [BR:msn00001]
 Metabolism
  Metabolism of other amino acids
   00473 D-Alanine metabolism
    LI99_07865
 Human Diseases
  Drug resistance
   01502 Vancomycin resistance
    LI99_07865
Enzymes [BR:msn01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.1  Acting on amino acids and derivatives
    5.1.1.1  alanine racemase
     LI99_07865
Peptidoglycan biosynthesis and degradation proteins [BR:msn01011]
 Precursor biosynthesis
  Racemase
   LI99_07865
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Ala_racemase_N Ala_racemase_C
Motif
Other DBs
NCBI-ProteinID: AIU13431
UniProt: P94967
LinkDB All DBs
Position
1665747..1666916
Genome map
AA seq 389 aa AA seqDB search
MQTTEPMTPPAPLASAQTVIDLGAIDHNVRVLRELAGSADVMAVVKADAYGHGALPVART
ALAAGAAALGVATIPEALALREGGITAPVLAWLHPPGTDFAPAIAADVEVAVSSRRQLEQ
VTAAAAEVGRTATVTVKVDTGLSRNGVGAADYPEVLDVLRRAQADGAIRVRGLMSHLVHG
DDPENPFNGLQGQRLADMRVYAREHGVDYEVAHLCNSPAAMTRPDLAFEMVRPGISLYGL
SPIPERGDMGLRPAMTLKCPVALVRSVHAGDGVSYGHRWVADRDTTLGLLPIGYADGVYR
ALSGRIDVLIKGRRRRAVGRICMDQFVVDLGPDADDVAVGDDAILFGPGANGEPTAQDWA
ELLDTIHYEVVTSPRGRVTRTYLPAGQQD
NT seq 1170 nt NT seq  +upstreamnt  +downstreamnt
atgcagaccaccgagcccatgacaccgcctgcgccactggcgtcggcacagacggtgatc
gatctgggcgccatcgaccacaacgtgcgcgtgctgcgcgaactcgccggttccgcggac
gtgatggcggtggtcaaggccgacgcctacggacacggggcgctcccggtggcccgcacc
gcgctggccgccggggccgccgccctcggtgtcgcgaccatccccgaggcgcttgcgctg
cgtgagggtggcatcacggcgccggtcctggcgtggctgcatccgcccggcaccgacttc
gccccggcgatcgccgccgacgtcgaggtcgccgtgtcgtcgcgccgccaactcgaacag
gtgacggcggccgcggccgaggtgggccgcaccgcgacggtgaccgtcaaggtcgacacc
gggctcagccgcaacggcgtcggcgcggccgactatcccgaggtgctcgatgtcctgcgc
cgcgcgcaggccgacggggcgatccgggtgcgcggtctgatgagccacctggtgcacggc
gacgacccggagaacccgttcaacggtctgcagggccaacggctggcggacatgcgtgtt
tacgcgcgcgagcacggcgtcgactacgaggtggcgcacctgtgcaactcgcctgcggcc
atgaccaggcccgacctggcgttcgagatggtgcgtcccggcatctcgctgtacgggctc
agtcccatccctgagcgcggcgacatgggcctgcggcccgcgatgaccttgaaatgcccg
gtggcgcttgtccgttcggtgcacgccggggacggggtgtcgtacgggcaccggtgggtg
gccgaccgtgacaccaccctggggctgctgccgatcggctacgccgacggcgtgtaccgc
gcactgagcgggcgtatcgacgtgctgatcaagggcaggcgcaggcgcgccgtcggccgg
atctgcatggaccagttcgtggtcgacctcggcccggacgcggacgacgtggccgtaggt
gacgacgccatcctgttcggcccgggcgccaacggcgaaccgaccgcgcaggactgggcc
gaactgctcgacaccattcactacgaggtcgtcacgagcccgcgcggacgcgtcacgcgc
acgtatcttccggcaggacaacaagattga

DBGET integrated database retrieval system