KEGG   Mycolicibacterium smegmatis INHR1: LI99_27260Help
Entry
LI99_27260        CDS       T03409                                 

Definition
(GenBank) serine/threonine protein kinase
Organism
msn  Mycolicibacterium smegmatis INHR1
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Lpp-LpqN Pkinase Pkinase_Tyr Pkinase_fungal APH Kdo DUF3185
Motif
Other DBs
NCBI-ProteinID: AIU17157
UniProt: A0A0D6IYV6
LinkDB All DBs
Position
5600243..5602099
Genome map
AA seq 618 aa AA seqDB search
MPLASGQVFAGFTIVRLVGTGGMGEVYLAKHPRLPREDALKVLPISVSADDEFRQRFIRE
ADMAATLWHPHIVGVHDRGEFEGRLWISMDYVDGHDAARLLHDKYPKGMPADDVVEIVTA
VGDALDYAHQRQLLHRDVKPANILVTEKHGTKRRIMLTDFGIARRTDDVNGLTSTNITVG
SMSYTSPEQLMGQPLDGRADQYSLAATAYRLLTGAPPFSHSNPAVVISHHLNSPPPKLGD
TKPALAKLDSVMAKALAKDAKDRFDTCHDFAVALAEANKGDESAAPVTAAPPPVITPPVQ
TAPPTTPLKAQTLPAPPTPPTPLSPSNPQAPTASQPPVFTSSWAGHDDPSGRQPVAVPAP
APPPPPPPSNFGPPPPAYSPPPRKSGGDRRKLIIAAAAIGAVVLLVGGITLAVTSGGDND
SAGAAATTSETASETPVTTTPKKPGEHAYTIADYIRDNKISETPVHRGDPNTPELTMPTP
PGWADAGTRTPAWAYSAIVNDPASPTDPPSVISLISKLDGNVDPEKLLEFAPNELQNLTE
WEPIGGVTRSNLSGFPSVQLGGSYLKDGKRRAITQKTVVVDIPSGIYVLQINADSLYRDF
GALVDVNKAIDKEATIKP
NT seq 1857 nt NT seq  +upstreamnt  +downstreamnt
atgccgttggctagcggtcaggtcttcgcggggttcaccatcgtccggttggtgggcacc
ggtggcatgggcgaagtgtatttggcaaagcatccgcggttgcctcgcgaagatgccctc
aaggtcctcccgatcagtgtcagcgccgacgacgagttccggcagcggttcatccgcgag
gccgacatggcggccaccctgtggcatccgcacatcgtcggcgtgcacgaccgcggggag
ttcgaaggccgcctgtggatctcgatggactacgtcgacggccacgacgcggcgcgtctg
ctgcacgacaagtaccccaaaggtatgccggccgacgacgtcgtggagatcgtcacggcc
gtcggcgacgcgctcgattacgcgcatcagcgccagctactgcaccgcgacgtcaagccc
gccaacatcctggtgaccgagaagcacggcaccaagcggcggatcatgctcaccgacttc
ggtatcgcgcgccgcaccgacgatgtcaacgggctcacgtccaccaacatcacggtggga
tcgatgtcctacacctcgcccgagcagctcatgggccagccgctcgacggccgggccgac
cagtattcgttggcggccaccgcctaccggttgttgacgggcgcaccgccgttctcgcac
agcaacccggccgtggtgatcagccaccatctgaactcgccgccgccgaaactgggcgac
accaaacccgcactggccaagctcgattcggtgatggccaaggcgctggccaaggacgcc
aaggaccggttcgacacgtgccacgacttcgcggtggcgctcgccgaggccaacaagggc
gacgagtcggccgcacccgtgacagccgccccgccgccggtgatcacgccgccggttcag
acggccccgccgacgacgccgctcaaggcgcagaccctgccggctcccccgacacccccg
acgcctctgtcgccatcgaacccgcaggcgcccacggcctcccagccgccggtgttcacc
tcgtcgtgggcaggccacgacgatccgtcgggcaggcagcccgtcgcggtcccggcgccc
gccccaccgccaccgcctccgccgtcgaacttcggtccaccgccgccggcctacagcccg
cctccgcgcaagtcaggaggtgaccgccgcaagctgatcatcgccgccgcggcgatcggg
gccgtggtgctgctggtgggcggcatcacgctggctgtcacctccggcggtgacaacgac
tccgcgggcgcggctgccacgacgtcggagacggcgtccgagacacccgtgacgacgacg
cccaagaaaccgggcgagcacgcctacacgatcgccgactacatccgggacaacaagatc
tccgaaaccccggtgcaccgcggcgatcccaacacgcccgagttgaccatgccgacccct
ccgggttgggcagacgcgggaacgcgcaccccggcgtgggcgtattcggcgatcgtcaac
gatcccgcctcgcccaccgatccgccgtcggtgatctcgctgatctcgaaactcgacggc
aatgtcgaccccgagaagctgctggagttcgcgcccaacgaactgcagaacctgaccgag
tgggaacccatcggcggcgtgacgcgcagcaatctcagcgggttcccgtcggtgcaactc
ggcggaagctatctcaaggacggcaagcgcagggccatcacgcagaagaccgtggtggtc
gacatcccgtcgggtatctacgtgttgcagatcaacgccgattcgctctaccgcgatttc
ggggccctggtcgacgtcaacaaggccatcgacaaagaggccacgatcaaaccgtga

DBGET integrated database retrieval system