KEGG   Mycobacterium smegmatis INHR1: LI99_31160Help
Entry
LI99_31160        CDS       T03409                                 

Definition
(GenBank) ATP-dependent DNA ligase
Organism
msn  Mycobacterium smegmatis INHR1
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DNA_ligase_A_M DNA_ligase_A_C
Motif
Other DBs
NCBI-ProteinID: AIU17915
UniProt: A0A0D6J1A5
LinkDB All DBs
Position
complement(6368397..6369452)
Genome map
AA seq 351 aa AA seqDB search
MGRMDLPVQPPIEPMLAKAQVKVPDEAGVWSYEPKWDGFRALVFRDGDDVVLQSRNGKDL
GRYFPELLDALRDELVEKCVLDGEVVVPRDIAGRVRLDWESLSQRIHPAASRIKMLAEQT
PAHFIGFDALALGDRSLLKEPFRVRREALAEAVDNKRWCHVTRTSEDPALGTEWLKTFEG
AGLDGVIAKRLDGPYLPGKREMVKVKHHRDADCVAMGYRIHKSGDGIGSILLGLYRDDGE
LQMVGGAASFTAKDRIKLLAELEPLREGDEMREGDPSRWNSAADKRWTPLRPEKVCEVAY
DQMEGNSVEGRRFRHAVKFLRWRPDREPSSCTFDQLDTPLNYDLYDVLEEQ
NT seq 1056 nt NT seq  +upstreamnt  +downstreamnt
atgggaaggatggacttgccggtgcagcccccgatcgaaccgatgcttgccaaggcgcag
gtgaaggtgcccgacgaggcgggggtgtggtcctacgagcccaagtgggacggtttccgc
gcgctggtgttccgcgacggtgacgacgtggtgctgcagtcgcgcaacggcaaggatctg
ggacggtactttcccgaactgctcgacgcgctgcgtgacgaactcgttgagaagtgcgtg
ctcgacggtgaggtcgtggtgccccgcgacatcgccggccgggtgcggttggactgggag
tcactgagccagcgcatccatcccgcggcgagccgcatcaagatgctcgccgagcagacc
ccggcgcacttcatcggcttcgacgccctggccctcggtgaccggtcgctgctcaaggag
ccgttccgggtgcgccgcgaggcgctggccgaggccgtcgacaacaaacggtggtgccac
gtcacccgcaccagtgaggatcccgcgctgggcaccgagtggctgaagacgttcgagggc
gccgggctggacggggtgatcgccaaacggctcgacggaccgtatctgcccggcaaacgt
gagatggtcaaggtcaagcaccaccgcgacgccgactgtgtcgcaatgggttaccgcatc
cacaagagcggcgacggcatcgggtcgatcctgctgggcctgtaccgcgacgacggggag
ctccagatggtcggcggcgcagcgtcgttcaccgccaaggatcgcatcaaactgctggcc
gaactcgaaccgctgcgcgagggcgacgagatgcgtgaaggcgaccccagccggtggaac
tcggcggccgacaagcggtggaccccgctgcgccccgagaaggtgtgcgaggtggcctac
gaccagatggagggaaactccgtcgagggcaggcgatttcgccacgccgtgaagttcctg
cgctggcgtcccgaccgggagccgtcgagttgcacgttcgaccagttggacaccccgctg
aactacgacctctacgacgtgctggaggaacagtga

DBGET integrated database retrieval system