KEGG   Mycolicibacterium smegmatis INHR1: LI99_33545Help
Entry
LI99_33545        CDS       T03409                                 

Definition
(GenBank) dihydroxyacetone kinase
  KO
K20901  L-erythrulose 1-kinase [EC:2.7.1.209]
Organism
msn  Mycolicibacterium smegmatis INHR1
Brite
KEGG Orthology (KO) [BR:msn00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    LI99_33545
Enzymes [BR:msn01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.209  L-erythrulose 1-kinase
     LI99_33545
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Dak1 Dak2
Motif
Other DBs
NCBI-ProteinID: AIU18378
UniProt: A0A653F837
LinkDB All DBs
Position
complement(6835384..6837099)
Genome map
AA seq 571 aa AA seqDB search
MTYLLNSPDDFADEAVRGLVAANPDLLTEVPGGVVRSTETPKGQPALVIGGGSGHYPAFA
GWVGPGMGHGAPCGNIFSSPSASEVYSVVRNAENGGGVILGFGNYAGDVLHFGLAAEKLR
HEGIDVRIVTVSDDIASNSPENHRDRRGVAGDLPVFKIAGAAIEAGADLDEAERVAWKAN
DATRSFGLAFEGCTLPGATEPLFHVEKGWMGVGLGIHGEPGVRDNRLGTAAEVADMLFDE
VTAEEPPRGENGYDGRVAVILNGLGTVKYEELFVVYGRIAERLAQQGFTVVRPEVGEFVT
SLDMAGVSLTMVFLDDELERLWTAPVETPAYRRGAMPAVDRTPRTTTWDAAETTIPEASE
GSRECARNIVAVLETFQQVCADNEAELGRIDAVAGDGDHGQGMSFGSRGAAQAARDAVDR
NAGARTTLLLAGQAWADAAGGTSGALWGAALTSAGGVFSDTDGADEQAAVDAICAGIDAI
LRLGGAQPGDKTMVDAAVPFRDALVKAFDTQAGPAITSAARVAREAAEKTADITARRGRA
RVLGEKSVGTPDPGALSFAMLMKALGEHLTR
NT seq 1716 nt NT seq  +upstreamnt  +downstreamnt
atgacgtacctcctgaactctccggacgacttcgccgacgaggcggtgcgcggtctcgtg
gccgccaaccccgatctgctcaccgaggtgcccggcggtgtcgtgcggtccaccgagaca
ccgaagggacaacccgcgctggtgatcggcggcggttcgggccactacccggccttcgca
ggctgggtcggcccaggcatgggccacggcgcgccgtgcggcaacatcttctcctcgccg
tcggcctccgaggtctactcggtggtgcgcaacgccgagaacggcggcggcgtcatcctc
gggttcggcaactacgccggtgacgtcctgcacttcggcctggccgccgagaagctgcgg
cacgagggcatcgacgtgcgcatcgtgaccgtcagtgacgacatcgcctccaacagcccc
gagaaccaccgcgaccgccgcggcgtcgcgggtgacctgccggtgttcaagatcgccggt
gccgcgatcgaagccggtgccgatctcgacgaggccgagcgcgtggcgtggaaggccaac
gacgcgacccgctcgttcggcctggccttcgagggttgcacgctgcccggcgcgaccgaa
ccgctgttccacgtcgaaaaaggctggatgggcgtcggactcggcatccacggtgaaccc
ggcgtccgcgacaaccgcctcggcacggcggccgaggtcgccgacatgctgttcgacgag
gtgaccgccgaggaaccgccgcgcggtgagaacgggtacgacggccgggtggccgtgatt
ctcaacggcctgggcaccgtgaagtacgaagagctgttcgtcgtgtacggccgcatcgcc
gaacgccttgcgcagcaaggattcaccgttgtgcgcccggaggtcggagagttcgtcacc
agcctcgacatggccggtgtgtcgctcaccatggtgttcctcgacgacgaactcgaacgg
ctgtggaccgcacccgtcgagacccccgcctaccgccgcggcgcgatgcctgccgtcgac
cgcacaccacgcaccaccacctgggacgccgcggagaccacgatcccggaggcgagtgag
ggctcgcgcgagtgtgcccgcaacatcgttgccgttcttgagaccttccagcaggtgtgc
gccgacaacgaggccgagctgggccgcatcgacgcggtcgccggcgacggtgaccacggc
cagggcatgtcgttcggttcgcggggcgccgcgcaggccgcgcgtgacgccgtggaccgc
aacgccggcgcccggaccacgctgctgttggccggtcaggcgtgggccgacgcggccggc
ggaacctcgggtgcgctgtggggcgcggcgctgaccagcgccggcggcgtcttcagcgac
accgacggcgcggatgaacaggccgccgtcgacgcgatctgtgccgggatcgatgccatc
ctgcgcctcggtggcgcgcagccgggtgacaagacgatggtcgacgccgccgttcccttc
cgcgatgccctggtgaaggccttcgacacccaggccggaccggcgatcaccagcgccgcc
cgggtggcgcgcgaggccgccgaaaaaactgcggacatcacggctcgacgtggccgcgcg
cgggtactcggggagaagagcgtcggcacgcccgatcccggggccttgtccttcgccatg
ctgatgaaggcgctgggcgagcacctcacccggtga

DBGET integrated database retrieval system