KEGG   Mycoplasma synoviae ATCC 25204: VY93_00655Help
Entry
VY93_00655        CDS       T04518                                 

Definition
(GenBank) serine/threonine protein kinase
  KO
K12132  eukaryotic-like serine/threonine-protein kinase [EC:2.7.11.1]
Organism
mso  Mycoplasma synoviae ATCC 25204
Brite
KEGG Orthology (KO) [BR:mso00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:mso01001]
    VY93_00655
Enzymes [BR:mso01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     VY93_00655
Protein kinases [BR:mso01001]
 Serine/threonine kinases: Other
  Bacterial family
   VY93_00655
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pkinase Pkinase_Tyr Kinase-like Kdo FTA2 APH Pkinase_fungal Fructosamin_kin
Motif
Other DBs
NCBI-ProteinID: AKB10900
LinkDB All DBs
Position
complement(124910..125908)
Genome map
AA seq 332 aa AA seqDB search
MNNSNIINDSNVYKKYEIISPLGEGGYANVFKIKSKFNNKYYALKYLNIQNKNSEFERFT
NEAHLIKNLNTEYVPKIFEFYKDTKEAYMVLELINGSLVSEKLKAHGRINVKDAVQIIKS
IAYAVQEIHSHKIIHRDIKSDNIYITIDGKIKIIDFGISIEDDVDQQRFTRESSVACSPF
FMAPEIVNRNKPINKSVDIYAIGILFYEMITGKVPFKGKTASETIKKHLSSEIPNPQSEV
EEIPNSVVNIIYKALQKDPEKRYKSTLDLIFDLENSLNPKFLNQSLFNPKNLQEKKNFSW
FIQSKFFLVSIFSFIALCFIGIFVLLHFFGVY
NT seq 999 nt NT seq  +upstreamnt  +downstreamnt
atgaataatagcaatattatcaatgattccaacgtttataaaaaatatgaaattatctct
cctcttggagaaggcggatacgccaatgtttttaaaataaaaagcaaatttaacaacaaa
tactacgctttaaaatatttaaatattcaaaataaaaatagtgaattcgagcgctttaca
aacgaagcgcatttaattaaaaatttaaataccgaatacgttccaaaaatttttgaattt
tataaagacaccaaagaagcttatatggttcttgaattaattaatggcagcttagtttca
gaaaagctaaaagctcacggtagaataaatgttaaagatgcggttcaaatcattaaatca
attgcatatgctgtgcaagaaattcatagccataaaataattcatagagacattaaaagc
gataatatctacattacaattgatggaaaaatcaaaataatagattttggtatttcaatt
gaagatgatgtcgatcaacaaagatttacaagagaaagctcagttgcttgttctccattt
tttatggcaccagaaattgtaaatagaaataagccaattaataaatcagtagatatttac
gctattggaattttattttacgaaatgataactggcaaggttcctttcaaaggaaaaacc
gctagtgaaactattaaaaaacatctttcaagcgaaattccaaatcctcaatcagaagta
gaagaaattccaaattctgttgttaatataatttataaagctctccaaaaagaccctgaa
aaaagatataaaagcactttagatttaatctttgatttagaaaattcactaaatcctaaa
tttttaaatcaaagtttatttaatcctaaaaatttacaagaaaagaaaaatttttcttga
tttattcaaagtaaattttttctagtatctatttttagttttatcgcgctttgttttatt
ggaatttttgtgctactgcatttttttggagtttattag

DBGET integrated database retrieval system