KEGG   Mycolicibacterium gilvum Spyr1: Mspyr1_01400
Entry
Mspyr1_01400      CDS       T01376                                 

Definition
(GenBank) phthalate 3,4-dioxygenase, alpha subunit
  KO
K18251  phthalate 3,4-dioxygenase subunit alpha [EC:1.14.12.-]
Organism
msp  Mycolicibacterium gilvum Spyr1
Pathway
msp00624  Polycyclic aromatic hydrocarbon degradation
msp01100  Metabolic pathways
msp01120  Microbial metabolism in diverse environments
msp01220  Degradation of aromatic compounds
Module
msp_M00636  Phthalate degradation, phthalate => protocatechuate
Brite
KEGG Orthology (KO) [BR:msp00001]
 09100 Metabolism
  09111 Xenobiotics biodegradation and metabolism
   00624 Polycyclic aromatic hydrocarbon degradation
    Mspyr1_01400
Enzymes [BR:msp01000]
 1. Oxidoreductases
  1.14  Acting on paired donors, with incorporation or reduction of molecular oxygen
   1.14.12  With NADH or NADPH as one donor, and incorporation of two atoms of oxygen into the other donor
    1.14.12.-  
     Mspyr1_01400
SSDB
Motif
Pfam: Ring_hydroxyl_A Rieske
Other DBs
NCBI-ProteinID: ADT96869
UniProt: E6TIQ1
LinkDB
Position
142890..144341
AA seq 483 aa
MQDHGEVLEAVRTGMIPAHVYNDKQIFSLEKERLFSRAWLFVAHESEIPQPGDYVVRQVL
QDSFIVARDSAGEIRVMFNMCLHRGMQVCRAEMGNASNFRCPYHGWSYRNDGRIIGLPFH
QEAYGGDAGFNKTGQTLLPAPSVASYNGLIFLSMDPDAESLEDYLGDFRFYLDFYTKQGP
NGLEVRGPQRWRVKANWKIAAENFAGDMYHTPQTHTSVVEIGLFREPKANKRKDGATYWA
GRGGGTTYKLPEGSFEDRMSYVGYPADMISRAKATWTEQQQQVVGTDGFMISAATCFPNI
SFVHNWPKVEDGEHVLPFISIRVWQPISENETEVLSWFAVDSDAPADFKADSYKAYLMCF
GSTGMFEQDDVENWVSLTNTAGGSMARRLRLNSRMGLLADDVRVVDTLSSAQFHGPGYAQ
LGYNENNQRQLLRLWADYLDMPPLRVNPATVLSDNPHGIEPMVQTNGAAAADIDSGSAES
VML
NT seq 1452 nt   +upstreamnt  +downstreamnt
atgcaggatcacggtgaggtgttagaggctgtacgcactggcatgatcccggcgcacgtg
tataacgacaagcagattttttcgctcgaaaaggagcgcttgttcagtcgggcgtggttg
ttcgtggcgcacgaatcggagattccgcaaccgggggactacgtggtcagacaagtgttg
caggattcgttcatcgtcgctcgtgattctgcgggcgagatccgggtgatgttcaatatg
tgcctccatcgcggtatgcaggtttgtcgggcggagatggggaacgcgtcgaacttcaga
tgcccgtaccacgggtggtcttaccgcaacgacggccgcattatcggactgccttttcac
caagaggcctatggaggagacgccgggtttaacaagacgggtcagaccctgttgccagcg
ccgagtgtggccagctacaacgggttgatcttcctgtcgatggatcctgacgcagaatcg
cttgaagactacctgggtgatttcaggttctatctcgatttctacaccaagcaaggcccc
aacggtctcgaggtgcgaggtccgcagcgttggcgggtaaaagcgaactggaagatcgca
gctgagaatttcgccggggacatgtaccacacacctcagacgcacacgtctgtggtggag
atcggcttgttccgagagccgaaggccaacaagcgcaaagacggcgccacgtattgggcg
ggtagaggtgggggcaccacatacaagctgcccgaggggagtttcgaggaccggatgagc
tacgtgggctacccggcggacatgatcagtcgagccaaggccacctggaccgagcagcag
caacaagtcgtcggcaccgacgggttcatgatctcggccgcgacgtgttttcccaacatc
agtttcgtgcacaactggccgaaagtggaggacggggagcacgtcttgccgttcatttca
atccgggtgtggcagccaatcagcgagaacgaaaccgaggtgctgtcgtggtttgcggtg
gattctgatgccccggcagactttaaggcggactcgtataaggcttatttgatgtgcttc
ggctcgacgggaatgttcgagcaagacgatgtcgagaactgggtgtcgctgaccaacacg
gcggggggttccatggcccgccgactgcggctgaacagccggatggggctgctcgcagac
gatgtacgggtggtcgacacccttagcagcgctcaattccacgggccgggatacgctcaa
ctcggttacaacgagaacaatcaacggcaattgttgaggctctgggccgactacctggac
atgccgccgcttcgcgtcaacccggctacggtgctcagcgacaatccgcatggaattgaa
ccaatggtccagaccaacggcgcggccgccgccgatattgactcggggtccgctgagtcg
gtgatgctatga

DBGET integrated database retrieval system