KEGG   Mycolicibacterium gilvum Spyr1: Mspyr1_01410
Entry
Mspyr1_01410      CDS       T01376                                 

Definition
(GenBank) phthalate 3,4-dioxygenase, beta subunit
  KO
K18252  phthalate 3,4-dioxygenase subunit beta [EC:1.14.12.-]
Organism
msp  Mycolicibacterium gilvum Spyr1
Pathway
msp00624  Polycyclic aromatic hydrocarbon degradation
msp01100  Metabolic pathways
msp01120  Microbial metabolism in diverse environments
msp01220  Degradation of aromatic compounds
Module
msp_M00636  Phthalate degradation, phthalate => protocatechuate
Brite
KEGG Orthology (KO) [BR:msp00001]
 09100 Metabolism
  09111 Xenobiotics biodegradation and metabolism
   00624 Polycyclic aromatic hydrocarbon degradation
    Mspyr1_01410
Enzymes [BR:msp01000]
 1. Oxidoreductases
  1.14  Acting on paired donors, with incorporation or reduction of molecular oxygen
   1.14.12  With NADH or NADPH as one donor, and incorporation of two atoms of oxygen into the other donor
    1.14.12.-  
     Mspyr1_01410
SSDB
Motif
Pfam: Ring_hydroxyl_B SnoaL_4 SnoaL_2
Other DBs
NCBI-ProteinID: ADT96870
UniProt: E6TIQ2
LinkDB
Position
144338..144937
AA seq 199 aa
MSVHDHQRIGQSAAPSVLGAHAARAQRVGDPLPFDDPRHLQAHSFLVNEAYLLDAQDYDR
WLGLLTEDIHYYMPVRITTAAGAGFDSSPGMAHFDENKYSLERRVARFATEHAWTEDPPS
RLRHFITNVRTFLSDDADHLVVDSAELLFRSRGDVNESTLISCGREDLLRRDGNALKLAR
RTICVDESVLRMQNLAVFL
NT seq 600 nt   +upstreamnt  +downstreamnt
atgagcgttcacgatcaccagcgcattggtcaatccgcggctccatcggtgctcggggcg
cacgcggcgcgcgcccaacgcgtcggcgacccgttaccgttcgacgaccctcgtcacctc
caggcgcatagtttcctcgtcaacgaggcgtacctcctcgatgctcaagactacgaccgg
tggctgggtctgctcacagaggacatccactattacatgccggtgcggatcaccaccgcc
gcgggagccggatttgatagctcaccgggaatggcgcatttcgacgagaacaaatactca
cttgagcgccgggttgcccgtttcgccaccgagcatgcctggactgaggatccgccgtcg
cgtctgcgtcacttcatcaccaatgtgcgcacattcctcagcgacgatgccgaccacctc
gtggtcgacagcgctgagttgcttttccgcagccgtggcgacgtcaacgagtccacgctc
atctcatgtggtcgtgaagatcttctacgtcgcgatggcaacgcgctcaaactcgcacgc
cgaacaatctgcgtcgatgaatcagtgcttcgaatgcagaatctggcggtcttcctatga

DBGET integrated database retrieval system