KEGG   Mycolicibacterium gilvum Spyr1: Mspyr1_01440
Entry
Mspyr1_01440      CDS       T01376                                 

Definition
(GenBank) ferredoxin
  KO
K18253  phthalate 3,4-dioxygenase ferredoxin component
Organism
msp  Mycolicibacterium gilvum Spyr1
Pathway
msp00624  Polycyclic aromatic hydrocarbon degradation
msp01100  Metabolic pathways
msp01120  Microbial metabolism in diverse environments
msp01220  Degradation of aromatic compounds
Module
msp_M00636  Phthalate degradation, phthalate => protocatechuate
Brite
KEGG Orthology (KO) [BR:msp00001]
 09100 Metabolism
  09111 Xenobiotics biodegradation and metabolism
   00624 Polycyclic aromatic hydrocarbon degradation
    Mspyr1_01440
SSDB
Motif
Pfam: Fer4_15 Fer4_13 Fer4_19
Other DBs
NCBI-ProteinID: ADT96873
UniProt: E6TIQ5
LinkDB
Position
146068..146268
AA seq 66 aa
MGGVIKAKREVCQGYANCVVAAPDYFDIDDRGLVEVRKTEVPSADRTRVEEAARSCPVAA
LEVVDE
NT seq 201 nt   +upstreamnt  +downstreamnt
atgggcggagttataaaggctaagcgcgaggtatgtcagggatacgcgaactgtgtcgtt
gcggccccggattacttcgacatcgacgatcggggactcgtggaggtccgcaagacggag
gtcccttccgcggacaggacccgggtcgaggaggctgcgcgcagctgtccggtggccgcg
ttggaagtcgtagacgaatga

DBGET integrated database retrieval system