KEGG   Mycolicibacterium gilvum Spyr1: Mspyr1_01450
Entry
Mspyr1_01450      CDS       T01376                                 

Definition
(GenBank) phthalate 3,4-dioxygenase, ferredoxin reductase subunit
  KO
K18254  phthalate 3,4-dioxygenase ferredoxin reductase component [EC:1.18.1.3]
Organism
msp  Mycolicibacterium gilvum Spyr1
Pathway
msp00624  Polycyclic aromatic hydrocarbon degradation
msp01100  Metabolic pathways
msp01120  Microbial metabolism in diverse environments
msp01220  Degradation of aromatic compounds
Module
msp_M00636  Phthalate degradation, phthalate => protocatechuate
Brite
KEGG Orthology (KO) [BR:msp00001]
 09100 Metabolism
  09111 Xenobiotics biodegradation and metabolism
   00624 Polycyclic aromatic hydrocarbon degradation
    Mspyr1_01450
Enzymes [BR:msp01000]
 1. Oxidoreductases
  1.18  Acting on iron-sulfur proteins as donors
   1.18.1  With NAD+ or NADP+ as acceptor
    1.18.1.3  ferredoxin---NAD+ reductase
     Mspyr1_01450
SSDB
Motif
Pfam: Pyr_redox_2 Pyr_redox Reductase_C 2-Hacid_dh_C NAD_binding_8 AlaDh_PNT_C XdhC_C DAO Pyr_redox_3 3HCDH_N NAD_binding_7 UDPG_MGDP_dh_N FAD_binding_2 K_oxygenase GIDA TrkA_N AdoHcyase_NAD Lycopene_cycl
Other DBs
NCBI-ProteinID: ADT96874
UniProt: E6TIQ6
LinkDB
Position
146265..147506
AA seq 413 aa
MTSRVVIVGSSVGGVRTAQALRSQGYDGDVVLVGEETALPYDKPPLSKALLAGTSDIAAA
TLLTRDAAAADRIELLLGRRAIGVDVAACQVEFADDEPLRYDHLVVATGASARPSPWGHG
SGVHVLRTLEDCLRLRADLVAGARLVVIGAGFIGAEVASTARSLGLQVTVVDPVPVPMSR
VLTEEIGGWFVDLHRDHGVHTRFGVGVENIEGERGNLKIGLTDGTVLEADTVVVGIGAVP
NDGWLMPSGLVVDDGLVCDEFCRAVTSQNIYAVGDVSRWFHRARGVTMRIEHWTNAVDQA
SCVAHNILYPDELRCYEPVEYVWSDQYDWKIQFCGQTTHLGEPLVVGDRLSDNRFTALYP
DREQRLSGAAIVNWPRALIECRRALQAGSDLESVRERLEVLTNPPDTAATRSP
NT seq 1242 nt   +upstreamnt  +downstreamnt
atgacgtcacgggtcgtcatcgtcggcagttctgtcggcggggtccgcacggcccaggcg
ctgcgctcgcaaggctacgatggcgacgtcgtcctggtgggcgaggaaactgcgctgccc
tacgacaagccgccgctatccaaagcgttgcttgcgggtacgagtgacatcgcggctgcg
acgttactcaccagagacgctgccgccgctgaccgcatcgagcttctcctcggccgccgc
gcgatcggagtggatgtcgcagcgtgtcaggtcgagttcgccgatgatgagcccctgcgt
tatgaccacctggtggtggccaccggagccagcgcgcgaccatccccgtggggccacgga
tcgggcgttcatgtgctccgcactctggaggactgtctgcggctaagagccgaccttgtc
gccggtgcccgcctcgtggtgatcggggcaggatttattggggccgaggtcgcgtcaacc
gcgcggtcactggggctgcaagtgacggttgtcgacccggtgccggtgccgatgagcagg
gttctgaccgaagagatcggtgggtggttcgtcgatttgcaccgagaccacggagtgcac
acgcgcttcggcgtcggtgtcgagaatattgagggggagcgcggcaaccttaagatcggc
ctcacggacgggaccgtcctagaagccgacacggtggtggtgggcatcggcgccgttccg
aatgacggctggctgatgccgtcgggactggtcgtcgatgacggcctggtctgcgacgag
ttctgccgcgccgtcacgtcacaaaacatctacgcagtcggcgacgtgtcgcgttggttt
catcgcgcccgcggcgtgacgatgcgcatcgaacactggacaaacgcggtcgaccaggcg
tcttgcgtcgcgcataatattttgtatcccgatgaattgcgctgctacgagcccgtcgag
tacgtctggagcgaccagtacgactggaagatccagttttgcggccagacaactcaccta
ggagagccactcgtcgtcggagatcgactgtccgacaatcgattcacagcgctctacccc
gatcgcgagcaacgtttgagcggcgccgcgatcgtgaactggcctcgagcactgatcgag
tgcaggcgtgcgctgcaggccggtagcgatctcgaaagtgtgcgggagaggctcgaagtg
ttgacgaacccacccgataccgccgcaacgcgatcgccatag

DBGET integrated database retrieval system