KEGG   Mycolicibacterium gilvum Spyr1: Mspyr1_49100Help
Entry
Mspyr1_49100      CDS       T01376                                 

Definition
(GenBank) ATP-dependent DNA ligase
Organism
msp  Mycolicibacterium gilvum Spyr1
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DNA_ligase_A_M DNA_ligase_A_C
Motif
Other DBs
NCBI-ProteinID: ADU01445
UniProt: E6TKH9
LinkDB All DBs
Position
complement(5095304..5096359)
Genome map
AA seq 351 aa AA seqDB search
MEAVDLPVRPPLEPMLAKAQAKVPDDPGVWSYEPKWDGFRALVFRDGDDVVLLSRSGKDL
GRYFPEVLDAVRDELAPHCVLDGEIVVPREIGGRMRLDWESLSQRIHPAESRITLLSEQT
PAHFIGFDALALGDTPLMKEPFRTRREALIDAVTPKQWCHVTRTTEDPQLGTQWLDEFEG
AGLDGVIAKRLDGPYLPGKREMVKVKHHRDADCVAMGYRIHKSGEGIGSILLGLYRDDGE
LQMVGGAASFTAKARLKLLDDLEPLRIGDDLRDGEPSRWNSAADKRWIPVRPERVCEVAY
DQMEGNTEHGRRFRHAVKFLRWRPDRDPQSCTFDQLDVPLHFDLYDVLERS
NT seq 1056 nt NT seq  +upstreamnt  +downstreamnt
atggaagccgtggacctccccgttcgaccgccactggagccgatgctggccaaggcgcag
gcaaaggtgcccgacgatcctggcgtgtggtcctacgaaccgaagtgggacggcttccgc
gcgctggtgttccgcgacggagatgacgtcgtcctgctgtcgcgcagcggcaaggacctc
gggcggtacttccccgaggtcctggatgcggtccgcgacgaactcgcgccgcactgcgtc
ctcgacggcgagatcgtcgtcccccgcgagatagggggacggatgcgactggactgggag
tcgctgagccagcggatccatcccgccgagtcccgcatcacgctgctgtcggagcagaca
cccgcgcacttcatcggcttcgatgccctggcgctcggagacaccccgctgatgaaagag
ccgttccggacccgccgcgaagcgctcatcgacgccgtgacgccgaaacagtggtgccac
gtcacccgcaccaccgaggatccccagctcggcacacagtggctcgacgagttcgagggc
gccggcctcgacggggtgatcgccaaacgtctcgacgggccttacctgcccggtaaacgg
gagatggtcaaggtcaagcaccaccgtgacgcagactgcgtggcgatgggctaccggatc
cacaagagcggcgagggcatcggctcgatcctgctcggcctgtaccgcgacgacggggag
ctgcagatggtcggcggcgcggcctcgttcaccgccaaggcgcggctgaagctgctcgac
gacctggaaccgctgcgcatcggcgacgatctacgcgacggtgaacccagccggtggaac
tccgcggccgacaagcgttggatcccggtgcgccccgaacgggtgtgcgaggtggcctac
gaccagatggaaggcaacaccgagcacggacgacggttccgccacgccgtgaagttcctg
cgctggcgccccgaccgggacccgcagagctgcacgttcgaccagctcgacgtccccctg
cacttcgacctctacgacgtgctggaaaggtcctga

DBGET integrated database retrieval system