KEGG   Mycolicibacterium gilvum Spyr1: Mspyr1_49270Help
Entry
Mspyr1_49270      CDS       T01376                                 

Definition
(GenBank) ATP-dependent DNA ligase
Organism
msp  Mycolicibacterium gilvum Spyr1
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DNA_ligase_A_M DNA_ligase_A_C
Motif
Other DBs
NCBI-ProteinID: ADU01462
UniProt: E6TKJ6
LinkDB All DBs
Position
5111896..5112996
Genome map
AA seq 366 aa AA seqDB search
MAGMRLPVMPPLSPMLSKSVQQIPDGASYEPKWDGFRSIVFRDGDEIEFGSRNERPMTRY
FPELVAAARSELPPRCVVDGEIVIATAGRLDFEALQLRLHPAASRVTMLAEKTPASFIAF
DLLALGDTDLTGRPFTERRAALVDALADAGPTFHVTPATRDIALATRWFDEFEGAGLDGV
IAKPVDGVYLPDKRTMFKIKHRRTADCVVAGYRLHKSGDDAVGSLLLGLYDSDGALASVG
VIGAFPMARRRALLAELQPLVTTFDEHPWNWAAHADPDVVRRHGGGSRWNAGKDLSFVPL
RPERVVEVRYDHMEGRRFRHMAQFNRWRPDRTPRSCTFDQLEQPVSFSLDDIGPGLTPRA
GRPYRS
NT seq 1101 nt NT seq  +upstreamnt  +downstreamnt
atggcggggatgcgccttcccgtgatgcccccgctctcaccgatgctctcgaagtcggtg
cagcagatcccggacggcgcctcgtatgaaccgaagtgggacggcttccggtcgatcgtg
ttccgtgacggcgacgagatcgagttcggcagccgcaacgaacgcccgatgacccgttac
ttcccggagcttgtcgcggcggcccgctccgagcttcccccgcgctgcgtcgtcgacggc
gagatcgtgatcgcgaccgccggcagactcgacttcgaggcgctgcagttgcgtctgcac
ccggccgcatcgcgggtcaccatgctggcggagaagaccccggcgtccttcatcgcgttc
gacctgctggctctcggcgacaccgacctgaccggccgcccgttcaccgaacggcgcgcg
gcactggtcgacgcgctcgccgatgccgggccgacgttccacgtcaccccggccacccgg
gacatcgcgctggccactcgatggttcgacgagttcgagggcgcgggcctggacggggtg
atcgccaagcctgtcgacggcgtctacctgccggacaagcggacgatgttcaagatcaag
caccggcgcaccgccgactgtgtggtcgcggggtaccggttgcacaagtccggtgacgac
gctgtcggctcgctgctgctcgggctctacgactccgacggcgcgctcgcgtcggtcggc
gtgatcggtgcgttcccgatggcgcggcgacgtgcgcttctcgccgaattgcagccgctg
gtgacgaccttcgacgagcatccgtggaactgggccgcgcacgccgacccggacgtcgtc
cgccggcacggcggcgggtcacggtggaacgccggcaaggacctgtccttcgtgccgctg
cgccccgaacgggtcgtcgaagtgcgctacgaccacatggagggcaggcggttccgccat
atggcgcagttcaaccggtggagaccggaccgcacgccgcgctcgtgcaccttcgatcag
ctcgagcagccggtgagtttcagcctcgacgacatcgggccgggcctcacgccgcgtgca
gggcgtccatataggtcgtga

DBGET integrated database retrieval system