KEGG   Marinobacter salinus: BKP64_00745
Entry
BKP64_00745       CDS       T04766                                 

Definition
(GenBank) phenol 2-monooxygenase
  KO
K03380  phenol 2-monooxygenase (NADPH) [EC:1.14.13.7]
Organism
msq  Marinobacter salinus
Pathway
msq00623  Toluene degradation
msq00627  Aminobenzoate degradation
msq01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:msq00001]
 09100 Metabolism
  09111 Xenobiotics biodegradation and metabolism
   00627 Aminobenzoate degradation
    BKP64_00745
   00623 Toluene degradation
    BKP64_00745
Enzymes [BR:msq01000]
 1. Oxidoreductases
  1.14  Acting on paired donors, with incorporation or reduction of molecular oxygen
   1.14.13  With NADH or NADPH as one donor, and incorporation of one atom of oxygen into the other donor
    1.14.13.7  phenol 2-monooxygenase (NADPH)
     BKP64_00745
SSDB
Motif
Pfam: FAD_binding_3 Phe_hydrox_dim DAO Thi4 FAD_binding_2 NAD_binding_8 Pyr_redox_2 HI0933_like Trp_halogenase FAD_oxidored SE
Other DBs
NCBI-ProteinID: AOY86821
UniProt: A0A1D9GGZ8
LinkDB
Position
complement(152013..153911)
AA seq 632 aa
MQFHHHGYVSTDPRVEEASGTGIDRPETLPDTVDVLIVGSGPAGMIAAAQLAKFPNITTR
VVERRSGRLEIGQADGIQARSVETFQAFGFAGRITEEAYRITEMAFWAPDADNPEHIARS
SVALDDPGGKISEFPHLIVNQARVLDYFAEFAKNAPARLTPDFGLEFVGLTTHDGEDYPV
EVTLRHTAGDNEGQECTVKAKYVIGCDGAHSRVRESIGRKHIGAVSNHAWGVMDVLATTD
FPDIRTKCAIQSSTGGSILLIPREGGHLFRMYVDLGEVPEDDNHQIRQTTLETTIKKANQ
ILHPYTLEVKNCAWYAVYEVGHRVTDKFDDVPPGEEDSRAPRVFITGDACHTHSAKAGQG
MNVSMQDGWNIAWKLGHVLSGIAPESLLSTYSSERQVVAQNLIDFDREWSSLMAKPAEEF
EDPKELADFYVKTAEFPAGFMTEYTESMITGTTEHQNLATGFPVGKRFKSERVTRVCDGN
DVHLGHHATADGRWRIYAFADKARPGEDSRLAAWAEWLFSSPDSPVVKYTPEGSDLDSIF
DVKVIYQQPHGEIEFGPNISAIFAPKVGPFQVTDYEKVYAIDPEVDIFDTRGIDRNGAVV
VVRPDHYVSQVLPLGNVDELASFFDGALHRSR
NT seq 1899 nt   +upstreamnt  +downstreamnt
atgcaatttcaccatcacggatacgtatccaccgatccgagagtcgaggaagcgtccggc
acgggcattgaccgcccggagacattgccggataccgtggatgtgctcatcgtcggcagc
ggacctgccggcatgattgccgctgcccagttggccaagtttccgaacattactactcgt
gtcgtcgaacggcgttcgggacgattggaaatcggccaggccgatggcatccaggcacgc
agcgtcgaaacattccaggcattcggttttgccggaagaatcactgaagaggcctaccgt
ataaccgagatggcgttctgggccccggatgccgataacccggagcacattgcccgctcc
tcggtggcattagatgatcccggcggtaagatcagcgagtttccccatctgatcgtcaac
caggcccgggttctcgattacttcgccgagttcgccaaaaacgcccccgcccggctgacc
cccgacttcggcctggagttcgtagggctgacgactcacgacggcgaggactatcccgtc
gaagtcacattgcgccataccgcgggcgataacgaaggtcaggaatgcacggtgaaagcc
aaatacgtcatcggttgcgatggcgcacacagtcgcgttcgtgaatcgattggccgcaag
cacatcggcgcggtttcgaatcatgcctggggtgtgatggatgtgctggccaccaccgac
ttcccggatatccgcaccaagtgtgccattcagtcatcaaccggtggcagtattctgctc
attccccgcgaaggcggtcacctgttccggatgtacgtcgacctcggcgaagtccccgag
gatgacaatcaccagatacgccagaccaccctggaaaccaccatcaagaaggccaaccag
atcttgcacccttataccctggaggtgaagaactgcgcctggtacgccgtctatgaggtt
ggccaccgagtgaccgacaaattcgatgacgttccacccggcgaagaagactcccgggct
ccacgggtgtttatcaccggtgacgcctgccatacccacagcgccaaagcaggtcagggc
atgaacgtatccatgcaggacggttggaacatcgcctggaagctgggccatgtgctctcc
ggcattgcacccgaatctctactcagtacctattcgagtgaacgccaggttgtcgcgcag
aacctgatcgacttcgatcgggaatggtcgagcttgatggccaagcccgccgaggagttc
gaggatccgaaagagctggcggatttttacgtgaaaaccgccgagtttccggctggcttc
atgaccgagtacacggagtcgatgatcaccggcaccacagaacaccagaacctggccacc
ggcttccccgttggcaaacggttcaaatcggagcgggtaacgcgcgtttgcgatggcaat
gatgtccacttgggtcaccatgccaccgccgacggccgttggcgaatctacgccttcgcc
gacaaggcccgtcccggggaggattcccgtttggccgcatgggcggagtggctgttcagc
tcacccgactcgccggttgtgaagtacacgcccgagggctcggacctggacagcatcttc
gacgtcaaggtgatctaccaacaaccccatggggagatcgaatttggcccgaacatctcc
gccatctttgcgccgaaggtggggcccttccaagtaacagactatgaaaaggtctacgcc
atcgatccggaagtcgacattttcgatacccgcggtatcgacagaaacggcgccgttgtc
gtagtgcgaccggaccattacgtttcgcaggtgctcccactgggcaacgtcgatgagctt
gcctcgttcttcgatggagccctgcaccgctcccggtga

DBGET integrated database retrieval system