KEGG   Marinobacter salinus: BKP64_04025
Entry
BKP64_04025       CDS       T04766                                 

Definition
(GenBank) thioredoxin-disulfide reductase
  KO
K00384  thioredoxin reductase (NADPH) [EC:1.8.1.9]
Organism
msq  Marinobacter salinus
Pathway
msq00450  Selenocompound metabolism
Brite
KEGG Orthology (KO) [BR:msq00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00450 Selenocompound metabolism
    BKP64_04025
Enzymes [BR:msq01000]
 1. Oxidoreductases
  1.8  Acting on a sulfur group of donors
   1.8.1  With NAD+ or NADP+ as acceptor
    1.8.1.9  thioredoxin-disulfide reductase
     BKP64_04025
SSDB
Motif
Pfam: Pyr_redox_2 Pyr_redox Pyr_redox_3 GIDA FAD_oxidored HI0933_like FAD_binding_2 NAD_binding_8 FMO-like NAD_binding_7 K_oxygenase Thi4 Trp_halogenase Shikimate_DH
Other DBs
NCBI-ProteinID: AOY87414
UniProt: A0A1D9GIQ5
LinkDB
Position
complement(865378..866331)
AA seq 317 aa
MSETKHSRLIILGSGPAGYTAAVYAARANLNPTLITGIEVGGQLTTTTDVDNWPGDNDGV
QGPELMQRMLKHAERFETSIVYDTINEADLRNRPFRLKGDGGEYTCDALIIATGASAMYL
GLESEEKFKGQGVSACATCDGFFYKKQKVAVIGGGNTAVEEALYLSNIADEVTLVHRRDS
LRAEKILQDKLFEKAENGNVKIVWDHTLNEVLGDGTGVTGMRIKSTKDDSTREIDLAGVF
IAIGHKPNTSLFEGQLDMSNGYIRIRSGLEGMATQSSIPGVFAAGDVADHVYRQAVTSAG
FGCMAALDAEKFLDQQD
NT seq 954 nt   +upstreamnt  +downstreamnt
atgagcgaaaccaaacattcccgactgatcattcttggctccggccctgccggctacaca
gccgcggtttatgctgcccgagccaacctcaacccgacactcatcacaggtatcgaagtc
ggcggtcagctcacaaccactaccgacgtggataactggcccggtgacaacgacggtgtc
cagggcccggaactgatgcagcgcatgctcaagcatgcagaacgatttgaaacaagcatc
gtttacgacaccatcaacgaggctgatttgcgcaatcgcccgttccgcctgaaaggcgac
ggtggtgaatacacctgcgatgcgctcattatcgcaacgggcgcatccgccatgtacctg
ggcctcgaatctgaagaaaagttcaaaggccagggagtatccgcctgcgccacctgcgac
ggtttcttctacaagaaacagaaagtcgcggtcattggcggcggcaacaccgctgtcgaa
gaggcgttgtacctttccaatattgccgatgaagtgaccctcgttcaccggcgagacagc
ctccgtgccgaaaagattttgcaggacaaactgtttgaaaaggcggaaaacggcaacgtc
aaaatcgtctgggaccataccctgaatgaagtgctcggcgatggtaccggtgtgacaggc
atgcgcataaaaagcaccaaggacgattccacccgcgagatcgatctcgccggcgtattc
atcgcaatcggccacaaacccaacaccagcttgttcgaaggccagttggacatgagcaat
ggctacatccgcattcgttccgggctcgaaggcatggctactcagagcagcatcccgggt
gtgttcgccgccggtgacgtggcagaccacgtataccgccaggcggtgacttctgccggt
tttggttgcatggcggccctggacgctgaaaagttccttgatcaacaggactga

DBGET integrated database retrieval system