KEGG   Marinobacter salinus: BKP64_06705
Entry
BKP64_06705       CDS       T04766                                 

Definition
(GenBank) dihydrolipoyl dehydrogenase
  KO
K00382  dihydrolipoamide dehydrogenase [EC:1.8.1.4]
Organism
msq  Marinobacter salinus
Pathway
msq00010  Glycolysis / Gluconeogenesis
msq00020  Citrate cycle (TCA cycle)
msq00260  Glycine, serine and threonine metabolism
msq00280  Valine, leucine and isoleucine degradation
msq00310  Lysine degradation
msq00380  Tryptophan metabolism
msq00620  Pyruvate metabolism
msq00630  Glyoxylate and dicarboxylate metabolism
msq00640  Propanoate metabolism
msq01100  Metabolic pathways
msq01110  Biosynthesis of secondary metabolites
msq01120  Microbial metabolism in diverse environments
msq01200  Carbon metabolism
Module
msq_M00009  Citrate cycle (TCA cycle, Krebs cycle)
msq_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
msq_M00036  Leucine degradation, leucine => acetoacetate + acetyl-CoA
msq_M00307  Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:msq00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    BKP64_06705
   00020 Citrate cycle (TCA cycle)
    BKP64_06705
   00620 Pyruvate metabolism
    BKP64_06705
   00630 Glyoxylate and dicarboxylate metabolism
    BKP64_06705
   00640 Propanoate metabolism
    BKP64_06705
  09105 Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    BKP64_06705
   00280 Valine, leucine and isoleucine degradation
    BKP64_06705
   00310 Lysine degradation
    BKP64_06705
   00380 Tryptophan metabolism
    BKP64_06705
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:msq04147]
    BKP64_06705
Enzymes [BR:msq01000]
 1. Oxidoreductases
  1.8  Acting on a sulfur group of donors
   1.8.1  With NAD+ or NADP+ as acceptor
    1.8.1.4  dihydrolipoyl dehydrogenase
     BKP64_06705
Exosome [BR:msq04147]
 Exosomal proteins
  Exosomal proteins of breast cancer cells
   BKP64_06705
SSDB
Motif
Pfam: Pyr_redox_2 Pyr_redox_dim Pyr_redox Pyr_redox_3 FAD_oxidored GIDA FAD_binding_3 FAD_binding_2 HI0933_like AlaDh_PNT_C DAO 3HCDH_N NAD_binding_8 K_oxygenase Thi4 Lycopene_cycl 2-Hacid_dh_C UDPG_MGDP_dh_N Agglutinin_C
Other DBs
NCBI-ProteinID: AOY87884
UniProt: A0A1D9GK38
LinkDB
Position
complement(1473117..1474559)
AA seq 480 aa
MSDKYDVIVIGAGPGGYVAAIKAAQLGLKTACVESWTSTDGKSQVLGGTCLNVGCIPSKA
LLEISHKYEETTHDYEMQGIIAKDVKMDIGKMMERKGGIVKQLTGGIAGLFKANGVTSIH
GHGKLLANRKVEVTDQEGKTKTYEAENVILASGSKPIQIPPAPFDGEYIVDSEGALEFTE
VPKRLGVIGAGVIGLELGSVWARLGAEVTVLEAQDTFLPTVDQQVAKDAMKQFQKQGLNI
VMGARMTGAEVKRKLVNVSYEDSKGKHEAKFDKLIVAVGRRPYTDNLLSEDAGVQMDERG
FIFVDDNCKTEAPGVWAVGDVVRGPMLAHKASEEGVMVAERIAGHKPQVNYDCIPNVIYT
APEVAWVGKTEEQLKAEGEDYNVGTFPFAANGRAMAANSASGLVKIIADAKTDRILGFHV
VGPQASEIVAQGVIAMEFGSSAEDLALTCFAHPTLSESVHEAALAVAGGAIHVANRRKKK
NT seq 1443 nt   +upstreamnt  +downstreamnt
atgtctgataagtacgacgtaattgtcattggtgcgggcccgggcggctacgttgctgcc
atcaaggcagctcagttgggccttaagaccgcgtgtgtcgagtcctggacatcgacagac
ggaaaaagccaggtgctcggtggtacctgtctgaacgttggctgcataccctcgaaggcg
ctgctggaaatttctcacaaatatgaggaaaccactcacgactacgagatgcagggcatc
atcgccaaagatgtcaaaatggacatcggcaaaatgatggagcgcaagggcggcattgtt
aagcagctgacaggtggtattgcaggactgttcaaggccaatggcgtaacgtctatccac
ggtcatggcaaactgctcgccaaccgcaaggttgaagtgactgaccaggaaggcaagacc
aaaacctacgaggccgaaaacgtgatcctggcatccggctccaagccgatccagatcccg
cctgcgccgttcgacggtgagtacatcgtcgactctgaaggcgctcttgagttcactgaa
gttccaaagcgccttggcgttatcggtgccggcgtgattggcctcgaattgggcagcgtc
tgggcgcgcctgggtgcagaagtgacagttctggaagctcaggatacgttcctgcctacc
gttgatcagcaagtggcgaaagatgccatgaagcagttccagaagcaggggctgaacatc
gtgatgggtgcccggatgacaggggccgaggtcaagcgcaagctggtcaacgtttcctat
gaagattccaagggcaagcatgaggcgaagttcgacaaactgattgttgccgtcggccgc
cgtccgtataccgataatctgttgtctgaagacgcgggtgtgcaaatggacgagcgcggc
tttatcttcgtcgacgacaattgcaagaccgaagcgccgggcgtttgggcggtcggtgat
gttgttcgtggtccgatgctggcgcacaaggcatccgaagagggtgttatggttgccgag
cgcattgcagggcacaagccccaggtgaattacgactgcatccccaatgtgatttatacc
gctccggaagtggcctgggtgggcaagactgaagagcagctgaaggcggaaggtgaggac
tacaacgtcggcacgttcccgttcgctgccaatggtcgtgcgatggccgccaactccgcc
tcgggactggtcaagatcattgcagacgcgaagaccgaccggatccttggtttccacgtg
gttggtccccaagcgtcggaaattgtcgctcagggcgtgattgccatggagttcggttcc
agcgccgaagatctggccctgacctgctttgcgcacccgactctgtcagagtcagtgcat
gaagcggccctggccgttgccggtggcgcgattcacgtcgcgaaccgtcgcaagaagaag
taa

DBGET integrated database retrieval system