KEGG   Marinobacter salinus: BKP64_07110Help
Entry
BKP64_07110       CDS       T04766                                 

Definition
(GenBank) glutathione S-transferase
  KO
K00799  glutathione S-transferase [EC:2.5.1.18]
Organism
msq  Marinobacter salinus
Pathway
msq00480  Glutathione metabolism
Brite
KEGG Orthology (KO) [BR:msq00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    BKP64_07110
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:msq02000]
    BKP64_07110
Enzymes [BR:msq01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.18  glutathione transferase
     BKP64_07110
Transporters [BR:msq02000]
 Other Transporters
  Pores ion channels [TC:1]
   BKP64_07110
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GST_N_3 GST_N GST_C GST_C_2 GST_N_2 GST_C_3 GST_N_4 GST_C_6 Tom37
Motif
Other DBs
NCBI-ProteinID: AOY90192
UniProt: A0A1D9GRG1
LinkDB All DBs
Position
1562124..1562774
Genome map
AA seq 216 aa AA seqDB search
MKIYGDTKSGNCYKVELVCNLLNIDHEWIDVDILAGGTKSDEFLKKNPNGKIPLLELDSG
ETLSESNAILNYLASGSDLYPHGGLAQAHVLQWQFFEQYSHEPFIAVARFINKYLGLPAE
KADEYAAKQTGGHKALQVMEQQLTRTPFLTGENFTTADISLYAYTHVADEGGFDLEAYPA
VRAWLDRVAALPNFRKPQNELERTNMTAYVCRFKNL
NT seq 651 nt NT seq  +upstreamnt  +downstreamnt
atgaaaatctacggcgataccaaatcaggcaattgctacaaagttgagctcgtctgcaac
ctgctgaacattgaccatgaatggattgatgtcgacatcctcgccggcggcacaaagtct
gatgaatttctgaaaaagaacccaaatggcaaaatacctctgcttgagctggatagcggc
gaaacgctttcagagtccaacgccatcctgaactaccttgcatcggggtctgatctgtac
cctcatggcggcttggcccaggctcacgttctgcaatggcaatttttcgagcaatacagt
catgagccgtttatcgctgtcgcacgatttatcaacaagtacctggggttgccggcggag
aaagctgatgaatatgccgccaagcaaacgggtgggcataaggcgttgcaggtgatggag
cagcagcttacacgaacgccatttttgactggcgagaatttcaccactgcagacatctca
ctctatgcttacacccacgtcgctgatgagggtggcttcgatctggaggcctatcccgcg
gttcgggcatggctggatcgcgttgccgcactgccgaatttccgaaagcctcaaaatgag
ctagagagaacaaacatgacagcctacgtatgtagattcaaaaacctatga

DBGET integrated database retrieval system