KEGG   Marinobacter salinus: BKP64_07520
Entry
BKP64_07520       CDS       T04766                                 

Definition
(GenBank) sucrose phosphorylase
  KO
K23079  glucosylglycerol phosphorylase (configuration-retaining) [EC:2.4.1.359]
Organism
msq  Marinobacter salinus
Brite
KEGG Orthology (KO) [BR:msq00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    BKP64_07520
Enzymes [BR:msq01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.359  glucosylglycerol phosphorylase (configuration-retaining)
     BKP64_07520
SSDB
Motif
Pfam: Alpha-amylase
Other DBs
NCBI-ProteinID: AOY88030
UniProt: A0A1D9GKX8
LinkDB
Position
1651820..1653262
AA seq 480 aa
MLLKNAVQLICYPNRIGKDLKDLHTVVEKHLSEAIGGLHILPFFPSNADGGFSPLTHKEV
DPDFGTWNDIEAFTQKYDLCVDLTVNHISDESPEFKDFIVNGFDSKYADLFVHVDKFGEI
SPDDMAKIHIRKEKEPFREVTLADGTKTRVWCTFTEQQIDLNYDADQAYTLMESYIGFLT
SKGVNLLRLDAFGYTTKRIGTSCFLVEPEVYRILDWINEVALKHGAECLPEVHDHTSYQY
AIGRRNMHPYGFALPPLLLYSLLDANSVYLKNWLRMCPRNMVTVLDTHDGICIPDVEGVL
PDEKIRVLIDNIDARSADPIMRRSAANIHSVGAIYQLTCTFYDALMQNDDAYIAARAIQF
FAPGIPQVYYVGLFAGCNDHELMEQSGELRDINRHYYSLDEVEQAVQKPVVQRLLGLMEF
RSNYPAFDGHFELNYSNNSSVAMAWRHGDYYCHLFVDLNFKTVKIEYYDVDTAQTKRLAC
NT seq 1443 nt   +upstreamnt  +downstreamnt
atgctgctaaaaaatgcagtgcagctgatttgttacccgaaccgcatcggcaaagatctg
aaggaccttcacaccgttgttgaaaagcatctgtcagaggccatcggcgggctgcatatc
ctgcctttctttccctccaacgccgatggcgggttttcaccattgacccacaaggaagtg
gatccggactttggcacctggaacgatattgaagccttcacacaaaaatacgacctgtgt
gtagacctcaccgtgaatcacatttccgatgaatctcccgaattcaaagacttcattgtc
aatggttttgactcaaagtacgccgatctgtttgttcatgtggacaaattcggcgagatc
tccccggacgatatggccaagatccacattcgcaaggagaaagaacccttccgggaggtc
acgctcgcggacggtaccaaaacccgggtgtggtgtaccttcacggaacagcagattgac
ctgaattacgatgctgatcaggcttacaccctgatggaaagctacatcgggttcctcacc
tccaaaggcgtgaacctgctcaggctcgacgccttcggctacaccaccaagcgaatcggc
accagctgctttctagtggagcccgaggtttaccggatactggactggatcaacgaagtg
gcgctgaagcatggcgcggaatgcctgccggaagtgcacgatcacaccagttaccagtac
gcgatcggccggcgcaacatgcatccttatggcttcgccttaccgccgttgctgctctat
tcgctgttagacgcgaacagcgtgtacctgaaaaactggctgcgcatgtgtccgcgtaat
atggtcaccgttctggatacacacgatggcatctgtatcccggatgtcgagggtgtgctg
ccggacgagaaaatcagggttctgatcgacaacattgatgcccgcagtgcggaccctatc
atgcgccgctccgcggccaatattcatagcgttggcgcgatctatcagcttacctgcacc
ttttacgacgccctcatgcaaaatgacgacgcctacatcgcggcccgggcaatccagttt
ttcgcacccggaattccacaggtctactacgttgggctgtttgcgggctgcaatgatcat
gagcttatggaacagagcggagagctgcgggatattaaccgccactattacagcctggat
gaggtggaacaggcggttcagaaaccggtcgtgcagcgcttactgggccttatggaattt
cgtagcaactaccctgcctttgacggccattttgaactgaactactccaacaactccagt
gtggccatggcctggcgccacggagattactactgccacttgtttgtcgacctgaacttc
aaaaccgtgaaaatcgaatattacgatgtcgacaccgcacagaccaaacggcttgcctgc
tga

DBGET integrated database retrieval system