KEGG   Marinobacter salinus: BKP64_10225Help
Entry
BKP64_10225       CDS       T04766                                 

Definition
(GenBank) phosphoenolpyruvate carboxylase
  KO
K01595  phosphoenolpyruvate carboxylase [EC:4.1.1.31]
Organism
msq  Marinobacter salinus
Pathway
msq00620  Pyruvate metabolism
msq00680  Methane metabolism
msq01100  Metabolic pathways
msq01120  Microbial metabolism in diverse environments
msq01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:msq00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    BKP64_10225
  09102 Energy metabolism
   00680 Methane metabolism
    BKP64_10225
Enzymes [BR:msq01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.31  phosphoenolpyruvate carboxylase
     BKP64_10225
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PEPcase PEPcase_2 DnaT
Motif
Other DBs
NCBI-ProteinID: AOY90242
UniProt: A0A1D9GRK8
LinkDB All DBs
Position
complement(2233288..2235894)
Genome map
AA seq 868 aa AA seqDB search
MLGELLGQSIRRQPGQECFELIEEIRAAAKADRHQESGSGQRLVSLLGKLSDDELLPVTR
AFNQFLNLANLAEQYHGIRRKRGHHSDLIVESLDEVFGRLQHGGVDPEELHKKVSDLRIE
FVLTAHPTEVARRTLIMKYDEMSECLARLDHDDLMPGEREEVVGRLSQLITEAWHTDEIR
HERPTAVDEAKWGFAVIENSLWQALPRFLRSLDTSLSEATGKGLPLRASPIRIASWMGGD
RDGNPNVTHQVTRKVFLLGRWMAADLYLRDIQALRAELSMWQASDELRERVGDAREPYRH
VLAELRERLIKTRDWAEASVNGHSADASGILFENEDFTAPLELCYRSLVECGLETIADGP
LLDTIRRAHTFGLPLIRLDIRQEASRHAEAVAEMVNYLGLGDYLSWTEEERQAFLVKELQ
GRRPLVPRNWEPSEQVQEVLATCEVVAQQTPQALGSYVISMASKPSDVLSVILLLRESGM
KHPLRVVPLFETLDDLRGAPDSMAALYEVEWYREYCQGRQEVMIGYSDSSKDAGQLMAAW
AQYQAQEKLTRVASQYGVHLTLFHGRGGTVGRGGGPANRAILSQPPGSVNGSFRITEQGE
MIRFKFGLPQLAIQSLTLYTTAVIEATLAPPPEPEDSWRETMDWLTERSLKAYREVVREN
PDFVPYFRQVTPEQALGKLSLGSRPARRKATGGVESLRAIPWIFAWTQMRLMLPSWLGSD
VALEAAARDNRLPVLRDMMAGWPFFRTYVDMLEMVLAKSDLRIATYYEQTLLDDDNLRAL
GEDLRARLKGCIERLLELKQQTDLLEDEPVFAHSMRVRSPYTDPLHYLQAELLRRDRQSE
GKGEVPELVERALKVTMAGISAGMRNTG
NT seq 2607 nt NT seq  +upstreamnt  +downstreamnt
atgctgggcgaactgcttggccagagtatccggcgccagccggggcaggaatgctttgaa
ttaatagaggagatccgcgcggcggccaaggccgacagacaccaggaaagcggttccggc
cagcgtctggtcagcctgcttggcaagctgagtgatgacgaactgctgccggtgacccgt
gcgttcaaccagtttcttaacctggccaacctggcagagcagtaccatgggatccgtcgt
aaacgcggccatcattccgacctgattgtggagtctctggacgaggtgttcggtcgcctt
caacatggcggagtggatccggaagagctgcacaaaaaggtctcggacctgcgcattgag
tttgttctgacggcgcacccgaccgaggtcgcccgccgtacgcttatcatgaaatacgac
gagatgtctgagtgtctggcccggctggaccacgatgatctcatgcccggagagcgcgag
gaagtcgttggccggctttcccaactgattaccgaagcctggcacaccgatgaaattcgc
catgagcggccaaccgccgtggacgaagccaagtggggctttgccgttatcgaaaacagt
ttatggcaagcgctgccgcgctttctgcggagcctggacacatcgctgtccgaggccacg
ggtaaggggctgccgttgcgtgcctcgccgatccggatagcttcctggatgggcggtgac
cgggacggtaatccgaacgttacccatcaggtcacccgcaaggtgttccttcttggtcgc
tggatggcggcggatctttacctgcgggacatccaggcattgcgggcagagctgtccatg
tggcaagccagtgacgaactccgtgaacgggttggtgatgcccgggagccctatcgtcat
gtgctggcggagcttcgggagcggcttatcaaaacccgggactgggcagaagccagcgtt
aacggccattccgcagatgcatcaggcatcctgttcgagaatgaagatttcacggcgccg
ctggagctctgttatcgatcgctggtggaatgcggactggagacaatcgccgatggtcca
ttgctggacaccattcgccgggcacacacgtttggcctcccgctgatccgcctggatatt
cgccaggaggcatctcgtcatgccgaggcagttgctgaaatggtcaattatcttggcctg
ggtgattacctgtcctggaccgaagaagagcgccaggcatttctggtcaaagaacttcag
ggcagacggccactggttccacgaaactgggagccatccgaacaggtgcaggaggtgctg
gcaacctgtgaggttgtggcgcagcaaaccccacaggccctgggctcctatgtcatctcc
atggccagcaaaccatccgatgtgctcagtgtgattcttctgttgcgggagtcgggcatg
aaacatccgctgcgagtggttcccctgtttgagactctggatgatttgcgcggcgcgcca
gacagcatggccgcactctacgaagtggagtggtaccgggaatactgccagggccgtcag
gaagtcatgattggctactcggattcgtccaaggatgccgggcagctgatggcagcctgg
gctcagtatcaggcccaggaaaagctgacacgtgttgcgagtcaatacggtgtgcacctg
accctttttcatggtcggggaggcacggtgggccggggtggcggtcctgcgaaccgcgcg
attctgtctcagccgcccggctcggtgaatggcagtttccgcatcaccgagcagggcgaa
atgattcggttcaaatttggcttgccgcaactggccatccagagtctaacgctctatacc
acggcggtgatcgaggctactcttgcgccaccgcccgaacctgaagattcctggcgtgag
accatggactggctgaccgagcggtcgctgaaggcgtaccgcgaggttgtgcgtgaaaat
ccggattttgtaccttatttccggcaggtgacaccggaacaagcccttggcaagctgtct
ttgggaagccgtccggccagaagaaaagctaccggtggtgttgaaagtctgcgggctatt
ccctggattttcgcgtggactcagatgcgcttgatgctgccgagctggctgggcagcgac
gtcgcgttggaggccgcagcccgggataatcgtcttccggtattgcgggacatgatggca
gggtggccgtttttccgaacctacgtcgacatgctggaaatggtgttggctaaatcggat
ttgcgcattgccacctattatgaacagactctgttggatgatgacaatctccgtgccttg
ggcgaagacttgagggcgcggctcaagggctgtattgaacgtcttctggagttgaagcaa
cagactgatctattggaagacgagcctgttttcgctcattccatgagggttcggagcccc
tataccgatccgttgcattatctgcaggccgagttgctcaggcgtgaccgccaaagcgaa
ggcaaaggtgaagtgcctgagttggtggagcgggctctgaaagttaccatggctggtatt
tccgcggggatgcgcaacaccggttag

DBGET integrated database retrieval system