KEGG   Marinobacter salinus: BKP64_12680Help
Entry
BKP64_12680       CDS       T04766                                 

Definition
(GenBank) penicillin-binding protein 1B
  KO
K05365  penicillin-binding protein 1B [EC:2.4.1.129 3.4.16.4]
Organism
msq  Marinobacter salinus
Pathway
msq00550  Peptidoglycan biosynthesis
Brite
KEGG Orthology (KO) [BR:msq00001]
 09100 Metabolism
  09107 Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    BKP64_12680
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01003 Glycosyltransferases [BR:msq01003]
    BKP64_12680
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:msq01011]
    BKP64_12680
Enzymes [BR:msq01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.129  peptidoglycan glycosyltransferase
     BKP64_12680
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.16  Serine-type carboxypeptidases
    3.4.16.4  serine-type D-Ala-D-Ala carboxypeptidase
     BKP64_12680
Glycosyltransferases [BR:msq01003]
 Polysaccharide
  Bacterial polysaccharide
   BKP64_12680
Peptidoglycan biosynthesis and degradation proteins [BR:msq01011]
 Peptidoglycan biosynthesis and degradation
  Glycosyltransferase/DD-Transpeptidase (Class A PBP)
   BKP64_12680
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Transgly UB2H Transpeptidase
Motif
Other DBs
NCBI-ProteinID: AOY88950
UniProt: A0A1D9GNJ0
LinkDB All DBs
Position
complement(2723733..2726063)
Genome map
AA seq 776 aa AA seqDB search
MKKTSPPSRSSKKSPRKSSRTGRRPRFWRFFVRASVIGLVLLAGWVIYLDAVVTSRFEGR
RFEVPSRVYARPLELYDGAGISSGALERELKLAGFRKGDGARAGSYRRNGGHFVISTRGF
RFPDGDEPRRRLSLNIYADRIQDFSVISGDASPVVRLEPAQIGGIYPSHKEDRVLVQLED
VPALLPATLMAVEDRNFYDHFGVAPLSIARAMLANIRAGQIVQGGSTLTQQLVKNFFLTR
DQTLLRKGNEALMSILLELHYEKGDILETYLNEVYLGQAGTRSINGFGLASQFYFGESLK
DLDVHQIALLVGMVKGPSYYNPRRHPQRATERRNLVISEMEDAGLIDSVRAARARGLALG
VSDKPSYSENRYPAYIDLVRRHLARDYRDEDLRSEGLRIFTTLNPATQYAAEFAVTDTLP
RLSSGETRKALEAALVVTSKDSGEVLALVGGRDPQFAGFNRALDARRPIGSLIKPFIYLS
ALEQPDRYTLITPVLDKSFVLEFDDGRRWEPKNYDGKERGEVPVHAALSHSYNLPAVRVG
LDVGVDVVKANLQAFGVSSEISEYPSMLLGAVAMNPVTVAQMYQGLATSGFNTPLRTIRE
VTDASGEALTRYSLEVDQVADPAAVHLVQYAMQETMQEGTGKSAYYTVPEELALAGKTGT
TDDGRDSWFAGFSGDLLAVAWVGRDDNGGTSLTGASGALPVWSRFMAQVPQHSLSPVVPD
GVNYHWVNGKRQALTGEYCDNARFMPFISGSEPTQEVSCSGTLQRRIKGWFEGLFQ
NT seq 2331 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaaaacgagcccaccttcccggtccagcaagaagtctccccgcaagtcatccagg
acgggccgtcgcccccggttctggcggttttttgtgcgcgcttcagtcattggcctggtg
ttgctggccggctgggtgatctatctggacgcagtggtgacctctcgtttcgaaggcagg
cgatttgaggttccctcccgggtgtatgcgcggcctctggaactatacgacggtgcgggt
atcagctctggtgcgctggaaagagagctgaagttggcgggcttccgcaagggggatggc
gccagggctggcagctaccgtcgcaacggtggacattttgttatcagtacccgtggattt
cgttttccggacggcgatgagccgaggcgcaggctttccctgaatatatacgccgaccgg
atccaggacttttccgtcattagtggcgatgcctcgccggttgttcgactggagcccgct
cagattggtggtatctatccctcccacaaggaagaccgggtcctggttcagcttgaggat
gtgccggcactgttgcctgcaacattgatggcggttgaggaccggaatttctacgaccac
ttcggtgtcgcgccactgtcgatagctcgcgcgatgctggcaaatatacgcgccggccag
atagtccagggcggtagtacgctgacccagcaattggtgaagaactttttcctgacccgg
gaccagacgctgttgcgcaaggggaatgaggcgctaatgtcgatcctgcttgagcttcat
tacgagaaaggcgacatacttgagacttacctcaacgaggtgtatctggggcaggcgggc
acccgtagtattaacggctttggtctcgcgagccagttttactttggtgaatccctgaaa
gatcttgatgtgcaccagatcgcattgctggttggaatggtgaaggggccaagttattac
aatccgcgccgccacccccagcgtgccacggagcgccgaaacctggtgatctccgaaatg
gaagatgcgggccttatagactcggtccgcgccgcgcgggccagagggctcgcactgggt
gtcagtgacaagccgtcctactctgaaaaccggtatccggcctatattgacctggtccgc
agacacctggcgcgggattaccgggatgaggatttgcggagtgaagggttgaggattttc
acgaccctgaatccggccacacagtatgcggccgaatttgcggtgaccgacacgctgccc
aggttgagcagcggcgaaacccgaaaagctctcgaagcggcgctggttgtgacgtccaag
gacagtggcgaggtgctggcgctggttggaggccgcgaccctcaatttgccggttttaac
cgggccctggatgcccgccgcccgatcggctccctgatcaagccgtttatctatctgtcc
gcgcttgagcagcccgatcgttataccctgatcacgccagtgctggataagtccttcgtc
ctggagtttgacgacgggcggcggtgggagcccaaaaactatgacggcaaagagcgtggc
gaggtgccggtgcatgcggcactgtctcactcctacaacctccccgcggttcgggtgggc
ctggatgttggcgtcgatgtagtcaaagcgaacctccaggcgtttggtgtaagctctgag
atatcagaatacccgtccatgttgctgggggctgtcgccatgaatcctgtcacggtggct
cagatgtaccaggggctggcgacttccggatttaatacgcccttgcgaaccattcgggag
gtgaccgatgccagcggagaagctttgactcggtacagtctggaagtggaccaggtggcg
gatcctgcggctgtccacctggttcagtacgcaatgcaggaaaccatgcaggaaggtacg
gggaaatctgcgtattacacagtgccagaggagctggcactggccggcaagaccggaaca
acggacgacggccgggactcctggtttgccggtttcagtggagacctgctggccgtcgcc
tgggtggggcgggatgataacggcggcacctcgctgaccggtgcaagcggtgccttaccc
gtttggtcccggttcatggcgcaagtgccccagcacagtctttcgcccgtggtacccgac
ggcgtcaattatcattgggtcaatggcaagaggcaggcattaaccggtgagtactgcgat
aatgcgcgctttatgccgttcatttcaggcagtgagccgacgcaggaggtatcctgctcg
ggtaccctgcagcggcgaattaaaggctggtttgaaggattgttccaatga

DBGET integrated database retrieval system