KEGG   Marinobacter salinus: BKP64_15760Help
Entry
BKP64_15760       CDS       T04766                                 

Definition
(GenBank) alkyl hydroperoxide reductase subunit F
  KO
K03387  NADH-dependent peroxiredoxin subunit F [EC:1.8.1.-]
Organism
msq  Marinobacter salinus
Brite
KEGG Orthology (KO) [BR:msq00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    BKP64_15760
Enzymes [BR:msq01000]
 1. Oxidoreductases
  1.8  Acting on a sulfur group of donors
   1.8.1  With NAD+ or NADP+ as acceptor
    1.8.1.-  
     BKP64_15760
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pyr_redox_2 Pyr_redox_3 Pyr_redox Thioredoxin_3 GIDA FAD_binding_2 FAD_oxidored HI0933_like Glutaredoxin DAO FAD_binding_3 K_oxygenase FMO-like NAD_binding_8
Motif
Other DBs
NCBI-ProteinID: AOY89507
UniProt: A0A1D9GPF4
LinkDB All DBs
Position
3405206..3406792
Genome map
AA seq 528 aa AA seqDB search
MLDASIKEQLKAYMEKLQQPIELVAAYDDGDKSQELKQLLEELEPMSDKISLRTEEAQDV
RRPSFAINRVGSDIGVRFAGIPMGHEFTSLVLALLQVGGHPSKASQDVIEQIQSLEGDFE
FETYFSLSCQNCPDVVQALNLMSVLNPNVKHTSIDGALFQDEVEKREVMAVPSVYLNGEP
WGQGRMTIEEIAARLDTKSDEKEAEKINQKDDFEVLVIGGGPAGSAAAIYAARKGIATGI
AAERFGGQVADTMGIENLISVPYTEGPKLVAAMEQHVKEYDVDIMNMQRAEKLIPAAKTG
GLHEVRLANGASLKSRTLVLSTGARWRQMGVPGEEEYRNKGVAYCPHCDGPLFKGKRVSV
IGGGNSGVEAAIDLAGIVGHVTLIEFGAEMRADEVLQKKLRSLKNVEIITSGQTTEITGE
NGKVSGLNYKDRTTGEEHHVALEGVFVQIGLVPNTEWLKGDIELSQHGEIIVNERNETSI
PGIFAAGDATTVPYKQIVISMGEGSKAALSAFDFLIRNSVEEDEEQAA
NT seq 1587 nt NT seq  +upstreamnt  +downstreamnt
atgttggatgccagtatcaaggaacagttgaaagcctacatggaaaagctgcagcagccg
attgagctggttgcagcctacgacgacggtgataaatcccaggagctgaagcagctgctt
gaagagcttgagccgatgtcggacaagatcagccttcgcacagaagaggctcaggacgtt
cgtcgcccgtcttttgctatcaatcgtgttggctccgatatcggtgtccgcttcgctggc
attcccatgggccatgagtttacgtctctggtgctggccctgttgcaggtgggcggccac
ccgtccaaggcgtctcaggacgtgattgaacagatccagtcactggagggagatttcgag
ttcgaaacctacttctccctgtcctgccagaactgtccggatgtggttcaggcgctgaac
ctgatgagcgtgttgaacccgaacgtcaagcacacgtccatcgacggcgcgctgttccag
gacgaagtggaaaaacgggaagtgatggctgtgcccagcgtttacctgaatggtgagccc
tggggccagggccgaatgacgatagaagagattgcggccaggctcgacacgaaatccgac
gagaaagaggcagagaagatcaaccagaaggatgactttgaagtcctggtaatcggtggt
ggtccggcgggttccgcagcggctatctacgccgctcgcaagggcattgcaaccggtata
gccgctgagcgcttcggtggccaggtggccgacaccatgggtatagagaacctgatctcc
gtgccctacactgaagggccgaagctggtggctgcgatggaacagcacgttaaagagtac
gacgtggacatcatgaacatgcagcgtgccgagaaactgattccggcggccaaaaccggc
ggcctgcatgaagtgcgtctggcgaatggcgcgtcgttgaagtcgcgtacgcttgtgctt
tccaccggtgcccgctggcgccagatgggcgttccaggcgaggaagaataccggaacaag
ggtgtggcctactgcccccactgtgacggcccgttgttcaaagggaagcgggtatccgtg
atcggcggtggtaactcgggtgttgaagcggcgatcgacctggctggcattgttggtcac
gtaacactgatcgaattcggtgcggagatgcgtgccgacgaggttcttcagaagaagctc
cggagcctcaagaacgtagagatcattacgtctggccagacgaccgagattaccggtgaa
aatggtaaggtcagcggtcttaactataaggatcgcaccaccggtgaagagcaccatgtc
gcccttgaaggggtgttcgtccagattggcctggttccgaatacagagtggttgaaaggc
gatatcgagctgagccagcacggcgagatcatcgttaacgagcgcaacgagacatccatt
ccgggaattttcgctgctggcgacgcaaccacggtgccttacaagcagatcgtgatctcc
atgggcgagggttcaaaggccgcgctgagtgccttcgacttcctgatccggaactctgtg
gaagaggacgaagaacaggcggcctga

DBGET integrated database retrieval system