KEGG   Marinobacter salinus: BKP64_16985Help
Entry
BKP64_16985       CDS       T04766                                 

Definition
(GenBank) glutamate decarboxylase
  KO
K01580  glutamate decarboxylase [EC:4.1.1.15]
Organism
msq  Marinobacter salinus
Pathway
msq00250  Alanine, aspartate and glutamate metabolism
msq00410  beta-Alanine metabolism
msq00430  Taurine and hypotaurine metabolism
msq00650  Butanoate metabolism
msq01100  Metabolic pathways
msq01110  Biosynthesis of secondary metabolites
msq01120  Microbial metabolism in diverse environments
msq02024  Quorum sensing
Module
msq_M00027  GABA (gamma-Aminobutyrate) shunt
Brite
KEGG Orthology (KO) [BR:msq00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00650 Butanoate metabolism
    BKP64_16985
  09105 Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    BKP64_16985
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    BKP64_16985
   00430 Taurine and hypotaurine metabolism
    BKP64_16985
 09140 Cellular Processes
  09145 Cellular community - prokaryotes
   02024 Quorum sensing
    BKP64_16985
Enzymes [BR:msq01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.15  glutamate decarboxylase
     BKP64_16985
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pyridoxal_deC Aminotran_5 Beta_elim_lyase
Motif
Other DBs
NCBI-ProteinID: AOY89731
UniProt: A0A1D9GQD6
LinkDB All DBs
Position
complement(3687577..3689253)
Genome map
AA seq 558 aa AA seqDB search
MTGKKKSAQASVEAMYRVFTVPEAPESTLSRIDQNISSNLAGFLQEHIVAVERDLSDVEK
DFSDYAIPEKPVFVSEQAQFLLDKLVANSVHTASPAFIGHMTSALPYFMLPLSKIMIALN
QNLVKTETSKAFTPMERQVLGMIHRLVYEEDGAFYRKWMHNPRYALGAMCSGGTIANLTA
LWVARNRAFPAEGSFRGLHQEGLFRALKYYGYEGAAIVVSRRGHYSLRKAADVLGLGRES
LVPVETDDENRIQPDALRDKCLELQRQKIKVMAICGVAGTTETGNVDPLDGMADIAREFG
AHFHVDAAWGGPTLFSRTHKHLLRGIEKADSVTFDAHKQLYVPMGVGLVVFKDPSLASAV
EHHAQYIIRKGSRDLGSTTLEGSRPGMSMLIHSGLKILAREGYEILIDQGIEKARTFAGL
IDAEPDFELVTRPELNILTYRYCPENVQQALAIADPLQAEKLNTCLNRITKFIQKTQRER
GKAFVSRTRLEPSRYYHFPCIVFRVVLANPLTTREILTDILAEQRELSAEEGIQDEMSIL
HQMADAVLKQHQPGARQA
NT seq 1677 nt NT seq  +upstreamnt  +downstreamnt
atgaccggaaagaaaaaatccgctcaggcctcagtcgaggccatgtatcgcgtgttcacg
gtgccagaggcgccggaatcgacgctgagccggatcgaccagaacatctccagcaatctt
gcagggttcctgcaggagcatattgtcgcggttgaacgggatctgtcggacgtcgagaaa
gacttctccgactatgcgatccctgaaaaacccgtgttcgtgtccgagcaggcccagttt
ctcctggataagctggtcgccaattccgttcataccgcctcccccgcatttatcggacac
atgacctcggcactgccgtatttcatgctgcctttgtccaagatcatgatcgcgctgaac
cagaacctggtgaagacggagacgtccaaagcgttcaccccaatggaacggcaggtcctg
ggcatgattcaccgcctcgtgtacgaggaagatggcgccttttaccgaaaatggatgcac
aacccccgctatgccttgggcgccatgtgctctggcggcaccattgccaacctgacggca
ctctgggtcgcacgcaaccgcgccttcccggccgaaggcagtttccgcggcctgcatcag
gaaggcttgttccgggccctgaaatactatggctacgaaggtgcggcgatcgtggtatcc
cgccggggccattactccctgcgcaaagccgcagatgtactcggcttgggccgggagtct
ctggtgccggtagagacggacgatgaaaaccgcatccagcccgacgccctgcgcgacaag
tgcctggaactgcagcgccagaagatcaaggtcatggcgatctgcggggtggccggcacc
accgaaaccggcaacgtagacccgctcgacggaatggcggacatcgcccgggaatttggc
gcccattttcatgtagatgcagcctggggcggcccgaccctgttctcccgaacccacaag
cacctgctgcggggcatcgagaaggccgactcggtcaccttcgacgcccacaaacagctt
tatgtgcccatgggcgtgggccttgtggtcttcaaggaccctagcctcgccagtgcggtc
gagcatcatgcccaatacatcatccggaaaggctcgcgggacctgggcagcacgaccctg
gagggttcccgtccgggcatgtccatgctgattcattcggggctgaagattctggctcgg
gaaggctacgagattctgatagaccagggcatcgaaaaggcccggacctttgccgggcta
attgacgcagaaccagactttgaactggttacccggccagagctgaacatcctcacctac
cgctactgcccggagaatgtccagcaggccctggccatagcggaccctttgcaggcggag
aagctcaacacctgcctgaaccgcatcaccaagttcatccagaaaacccagcgggagcgg
ggcaaggctttcgtctcacggacgcgcctggaaccgtcccgctactaccacttcccctgt
atcgttttccgggtggtgctggcaaacccgctgaccacgagggagattctgacggacatt
ctggctgagcagcgggaactgtcagcggaagaagggattcaggacgagatgagcattctg
caccagatggccgatgcggtactgaagcagcaccagccaggtgccagacaggcctga

DBGET integrated database retrieval system