KEGG   Marinobacter salarius: AU15_00820Help
Entry
AU15_00820        CDS       T03593                                 

Definition
(GenBank) glutamyl-tRNA(Gln) amidotransferase
  KO
K02433  aspartyl-tRNA(Asn)/glutamyl-tRNA(Gln) amidotransferase subunit A [EC:6.3.5.6 6.3.5.7]
Organism
msr  Marinobacter salarius
Pathway
msr00970  Aminoacyl-tRNA biosynthesis
msr01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:msr00001]
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    AU15_00820
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03029 Mitochondrial biogenesis [BR:msr03029]
    AU15_00820
Enzymes [BR:msr01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.5  Carbon-nitrogen ligases with glutamine as amido-N-donor
    6.3.5.6  asparaginyl-tRNA synthase (glutamine-hydrolysing)
     AU15_00820
    6.3.5.7  glutaminyl-tRNA synthase (glutamine-hydrolysing)
     AU15_00820
Mitochondrial biogenesis [BR:msr03029]
 Mitochondrial DNA transcription, translation, and replication factors
  Mitochondrial transcription and translation factors
   Other mitochondrial DNA transcription and translation factors
    AU15_00820
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Amidase TMEM215
Motif
Other DBs
NCBI-ProteinID: AHI30442
UniProt: W5YMM6
LinkDB All DBs
Position
complement(172648..174105)
Genome map
AA seq 485 aa AA seqDB search
MHNKSVAELSRDLESGKISSVELTRQFLGRLEKEDEQLNSFITITEEQALADAHAADEQR
AAGKATPWTGVPFAHKDIFCTNGVATTCGSKMLANFVPPYDATVTENFRKAGAVCLGKTN
MDEFAMGSSTESSYFGATANPWGLSQGEKRVPGGSSGGSAAAVAARLVPAATATDTGGSI
RQPAALCGVTGLKPTYGRVSRYGMIAFASSLDQGGTMARTAEDNALMLNVMAGFDPKDST
SIDRDVPDYTATLNEPLTGLRIGLPKEYFAGNLSAAMEEQVRGAIREYEKLGATVKEVSL
PHADLAIAAYYVIAPAEASANLSRFDGARYGYRCEDPKDLLDMYTRTRAEGFGTEVKRRI
LVGTYALSAGYFDAYYLKAQKVRRLIQQDFINAFKEVDVLMSPTTPSPAFIQGEKTSDPV
TMYLEDVFTIAINLAGIPAMSVPAGFVDGLPVGLQIIGDYFSEARLLNAAHQFQQVTDWH
QREPQ
NT seq 1458 nt NT seq  +upstreamnt  +downstreamnt
atgcataacaaatccgtagcagagctttcccgagatctggaaagcggcaagatttccagc
gtggagctgacccggcagttcctgggccgccttgaaaaggaagatgagcagctcaacagc
tttatcaccattacggaagaacaggccctggccgacgcccatgcggcagacgagcaacgg
gcagcgggtaaggccacaccctggacgggtgtgcccttcgcccacaaggacatattctgc
accaatggcgtggcgaccacctgtggctcgaagatgctggcgaattttgtgccaccctac
gatgcaacggtcacggagaatttccgcaaggcgggcgctgtgtgcctgggtaagaccaac
atggacgagttcgccatggggtcgtctaccgagtccagctactttggcgccactgccaac
ccctggggtctgagccagggcgagaagcgggtgccgggcggctcttccggcggctccgcg
gcggcggttgcagcgcggctggtgcccgcggcgacagccacggataccggcggatccatc
cgtcaaccggccgcgctgtgtggcgtgaccgggctgaaaccaacctatggtcgggtgtcc
cgttacggcatgattgcctttgcttcgagcctggaccagggtggcaccatggcccgcaca
gccgaagacaatgcgctgatgctgaatgtaatggcgggctttgaccccaaggactccacc
tccattgaccgtgacgttccggactataccgcaacgctgaacgagccgttgacagggtta
cgcatcgggctgccgaaggaatactttgctggcaacctcagtgccgccatggaagaacaa
gttcggggtgctatccgggagtacgagaagctcggcgccacggtaaaggaagtgtccctt
ccccacgctgacctagccatcgcggcctactacgttatcgcaccggccgaggcctcggcc
aacttgtcccgttttgacggcgcccgttatggctaccgctgcgaagacccgaaagacctg
ctggacatgtacacacgcacccgggccgaaggtttcggcaccgaggtcaagcggcggatt
ctggtgggcacctacgccctgtccgccggttacttcgacgcctattatctgaaagcccag
aaggttcgtcggctgatccagcaggacttcattaacgccttcaaggaagtggatgtgctg
atgagccccaccacgccctccccggcttttatacagggcgagaaaaccagcgacccggtg
accatgtacctggaggacgtgtttaccattgccatcaacctggcgggcatccccgccatg
tccgttccagccgggtttgtggacgggcttccagtgggcctgcagattattggggattat
ttctccgaagctcgcctgctgaacgccgcccatcaatttcagcaggtgaccgactggcac
cagcgcgaaccgcaataa

DBGET integrated database retrieval system