KEGG   Marinobacter salarius: AU15_20235
Entry
AU15_20235        CDS       T03593                                 

Definition
(GenBank) hypothetical protein
Organism
msr  Marinobacter salarius
SSDB
Motif
Pfam: DUF4400 RanGAP1_C RuvC_1 DUF3488
Other DBs
NCBI-ProteinID: AHI32714
UniProt: W5YV07
LinkDB
Position
complement(4180522..4181250)
AA seq 242 aa
MPEGKSEHPAQKRGFVGKSIDLILKVIGLLLFSAFMSIVIEWINMGFFQDEPTYKNAEEM
MFQEIGYLSESLNSKDQTNEGAVNSASSTITKVVSFLFVDSGLLDSLQSVRTPDANDGQI
ILMMKGVIAEYYEYLMAAIYILIMFFVRIAVLMLSMPAFVLFGVVGVCDGLMQRDLRRWR
GGNESGYVYHWAKKFAIPTLALAWILYLAIPSSIHPNYMITPFAVLFGLCLMVMSSKFKK
YL
NT seq 729 nt   +upstreamnt  +downstreamnt
atgccagagggtaaatcggaacatcccgctcagaagcgtggctttgtcggcaaatcaatc
gatctgattctgaaagtcattggcctgctgttgttcagtgcgttcatgtcgatcgtcata
gagtggatcaacatgggcttcttccaggatgagcccacctacaaaaatgcggaagagatg
atgttccaggagatcggctatctgagtgaatcgctgaactcgaaagaccaaacaaatgag
ggcgctgtgaattccgcaagctcgaccattaccaaagtggtcagctttctatttgtcgat
tctggcctgctggacagtttgcagtcggtgagaacacccgacgccaacgacggtcagatt
attctgatgatgaagggcgtgatcgccgaatattatgagtacctgatggcggccatatat
atcctgatcatgttcttcgtccggattgcggtgctaatgctctctatgccggctttcgtg
ctattcggggtcgttggcgtctgtgacggactgatgcagcgtgacttaaggcggtggcgc
ggtggaaatgagtctggctatgtctatcactgggcgaaaaagtttgcgattccgactctt
gccctcgcgtggattttatacctggcgattcccagttccatccatccgaactatatgatc
acaccattcgctgtcctgtttggactgtgtttaatggtgatgagctcgaaattcaaaaag
tacctctga

DBGET integrated database retrieval system