KEGG   Mycobacterium stephanolepidis: MSTE_00253Help
Entry
MSTE_00253        CDS       T05257                                 

Definition
(GenBank) putative DNA ligase LigC
Organism
mste  Mycobacterium stephanolepidis
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DNA_ligase_A_M DNA_ligase_A_C
Motif
Other DBs
NCBI-ProteinID: BAX95599
UniProt: A0A1Z4ERL7
LinkDB All DBs
Position
complement(250755..251804)
Genome map
AA seq 349 aa AA seqDB search
MPPIAPMLAKPVAKIPADASYEPKWDGFRSIVFRDGNEVELGSRNEKPLTRYFPELAAAV
LAELPPRCVVDGEIVIATASGLDFEALQQRIHPADSRVRLLAEQTPASFIAFDLLALGDE
DFTGRPFSERRAALTDALSGAGTSIHLTPATTDHDTAERWFEEFEGAGTDGLIAKPLTIA
YQPDKRVMFKIKPERTADCVVAGYRVHKSGDDAIGSLLLGLYQDDGALASVGVIGAFPMA
ERKRLFQELQPLVTDLEDHPWNWAAHQAGERTPQKNAGSRWNAGKDLSFVALRPERVVEV
RYDHMEGVRFRHTAQFNRWRPDRDPRSCTYEQLERPIAFSLNEIVPGLV
NT seq 1050 nt NT seq  +upstreamnt  +downstreamnt
atgcctcctatcgcgccaatgcttgcgaaacctgtcgcgaaaatcccggccgacgcgtca
tacgagcccaagtgggatgggttcaggtcgatcgtctttcgcgacggcaatgaggtggag
ctgggcagtcgcaacgaaaagccgctgacccggtactttccggagctggcggcggccgta
ctggccgagctgcccccgcggtgcgttgtcgacggggagatcgtgatcgccaccgcgtcg
gggctggacttcgaggcgctgcagcagcggattcatccggcagattcccgggtgcggctg
ctggctgagcagacgcccgcctcattcatcgctttcgacctgctcgcgctgggggacgag
gacttcaccggacgaccgttcagcgagcgccgtgccgcgctgacggacgcgctgtccggg
gcaggcacctcgattcatctcacccccgccaccaccgatcacgacacggcagagcgctgg
ttcgaggagttcgagggtgccggaaccgacggcctcatcgcgaaaccattgaccatcgcc
taccagcccgacaaacgggtgatgttcaagatcaaacccgagcgcaccgccgattgcgtg
gtggccggatatcgggtgcacaagtccggtgatgacgccatcggatcactgctgctgggt
ctgtatcaggacgacggtgcgttggcctcggtcggcgtgatcggcgcgtttccgatggcc
gaacgcaagcggctcttccaggagctgcaaccgctcgtcaccgacctggaggatcaccct
tggaactgggcggctcatcaggccggtgaacgcactccgcagaagaacgccggctcacgc
tggaatgctggcaaggacctgtcgttcgtcgcgctacgccccgaacgggtggtggaggtc
cgctatgaccacatggagggtgtgcggtttcgccacaccgcacaattcaaccgctggcgc
ccggatcgcgatccgcgttcctgcacctatgaacagctcgaacggccaatcgcgttcagt
ctcaacgagattgttccgggtctggtgtga

DBGET integrated database retrieval system