KEGG   Mycobacterium stephanolepidis: MSTE_02678Help
Entry
MSTE_02678        CDS       T05257                                 

Definition
(GenBank) putative enoyl-CoA hydratase/isomerase
  KO
K01692  enoyl-CoA hydratase [EC:4.2.1.17]
Organism
mste  Mycobacterium stephanolepidis
Pathway
mste00071  Fatty acid degradation
mste00280  Valine, leucine and isoleucine degradation
mste00281  Geraniol degradation
mste00310  Lysine degradation
mste00360  Phenylalanine metabolism
mste00362  Benzoate degradation
mste00380  Tryptophan metabolism
mste00410  beta-Alanine metabolism
mste00627  Aminobenzoate degradation
mste00640  Propanoate metabolism
mste00650  Butanoate metabolism
mste00903  Limonene and pinene degradation
mste00930  Caprolactam degradation
mste01100  Metabolic pathways
mste01110  Biosynthesis of secondary metabolites
mste01120  Microbial metabolism in diverse environments
mste01130  Biosynthesis of antibiotics
mste01212  Fatty acid metabolism
Module
mste_M00087  beta-Oxidation
Brite
KEGG Orthology (KO) [BR:mste00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00640 Propanoate metabolism
    MSTE_02678
   00650 Butanoate metabolism
    MSTE_02678
  09103 Lipid metabolism
   00071 Fatty acid degradation
    MSTE_02678
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    MSTE_02678
   00310 Lysine degradation
    MSTE_02678
   00360 Phenylalanine metabolism
    MSTE_02678
   00380 Tryptophan metabolism
    MSTE_02678
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    MSTE_02678
  09109 Metabolism of terpenoids and polyketides
   00903 Limonene and pinene degradation
    MSTE_02678
   00281 Geraniol degradation
    MSTE_02678
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    MSTE_02678
   00627 Aminobenzoate degradation
    MSTE_02678
   00930 Caprolactam degradation
    MSTE_02678
Enzymes [BR:mste01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.17  enoyl-CoA hydratase
     MSTE_02678
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ECH_1 ECH_2 DUF370
Motif
Other DBs
NCBI-ProteinID: BAX97987
UniProt: A0A1Z4EYH3
LinkDB All DBs
Position
complement(2664958..2665767)
Genome map
AA seq 269 aa AA seqDB search
MSFVLVDRPRPDIALVTLNRPERMNAMAFDVMLPFKQMLVDISHDNDVRAVIITGAGKGF
CSGADQKSAGPIPHIGGLTQPTIALRSMELLDEVILTLRRMHQPVIAAINGAAIGGGLCL
ALACDVRVASEAAYFRAAGINNGLTASELGLSYLLPRAIGTSRASDIMLTGRDVDADEAE
RIGLVSRKVASESLLEECYAIGERIAGFSRPGIELTKRTIWSGLDAASLESHMHQEGLGQ
LYVRLLTDNFEEATAARKEQRKAAFRDKR
NT seq 810 nt NT seq  +upstreamnt  +downstreamnt
atgagtttcgtgctggtcgaccgtccgcgtccggatattgccctggtcaccctgaaccgg
ccggagcggatgaacgccatggcgttcgatgtgatgctgcccttcaagcagatgctcgtc
gacatcagccacgacaacgatgtgcgcgccgtcatcatcaccggggccggtaaggggttt
tgttcgggcgccgatcagaaatccgccgggcccatcccgcatatcgggggattgacccag
ccgactatcgcgctgcgctcgatggagctcctcgacgaggtcatcctcacgctgcgccgg
atgcatcagccggtgatcgcggccatcaacggggccgccatcggtggtggcctgtgcctg
gcgctggcctgcgatgtccgggtggcatcggaggccgcctacttccgggccgccggtatc
aacaatgggctgaccgccagtgagctgggcctgagttacctgctgccgcgtgccatcggc
acgtcccgcgcttcggacatcatgttgaccggccgcgacgtcgacgccgacgaggccgaa
cgcatcggtttggtatcccgcaaggtggcctcagagtcgctgctggaagagtgttacgcg
attggagagcgcatcgccgggttctcccgtccagggatcgaattgaccaagcgcaccatt
tggagtgggctggacgccgctagcctggaaagtcacatgcaccaagagggcctgggccag
ctgtatgtccggctgctcaccgacaacttcgaagaagccaccgctgcccgcaaggagcag
cgtaaagcggcctttagagacaagcgctga

DBGET integrated database retrieval system