KEGG   Mycobacterium stephanolepidis: MSTE_03831Help
Entry
MSTE_03831        CDS       T05257                                 

Definition
(GenBank) hypothetical protein
  KO
K07058  membrane protein
Organism
mste  Mycobacterium stephanolepidis
Brite
KEGG Orthology (KO) [BR:mste00001]
 09190 Not Included in Pathway or Brite
  09194 Poorly characterized
   99996 General function prediction only
    MSTE_03831
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Virul_fac_BrkB
Motif
Other DBs
NCBI-ProteinID: BAX99129
UniProt: A0A1Z4F1Q8
LinkDB All DBs
Position
complement(3794294..3795319)
Genome map
AA seq 341 aa AA seqDB search
MAEDDKPGILDRYRARFPWFDHIMRMQERYQKVNGNFYAAGITYFTVFALFPLMMVGFAV
MGFVLSRRPDTIAELRGRISGAISGEVGNQLINLMDTAIASRTSLGIAGLATAAWAGLGW
MANVRAALSAMWEQPNDSDGFVRGKLSDLVALGSTFVALALTIAVTVVGNEKTILRILGW
VGLHDVSIPAVLLKVVTIAIATVLSWALFTWMISRLPRERLPFSSAVRAGLIAAIGFELF
KQVASIYLSVIMHGPAGSTFGPVLGIMVFAYITARLLLYATAWAATSDENQPFVYVPPPE
PVVITTRIETVERPSKLGVLAAFGAGALGALGISWLGRGGD
NT seq 1026 nt NT seq  +upstreamnt  +downstreamnt
gtggccgaagacgataagcccgggattctcgaccgctatcgcgcaaggtttccctggttc
gaccacatcatgcgcatgcaggagcgctaccaaaaggtcaacggcaacttctacgccgca
ggaatcacgtatttcacggtctttgcgctgtttccgctgatgatggtcggattcgcggtc
atgggcttcgtgttgtccaggcgaccggacacgatagcggagttacggggccggatcagc
ggggcgatctccggcgaagtgggcaatcagctaatcaatctgatggataccgccattgcc
tcgcgcaccagcctgggcatcgcgggtcttgcgaccgcggcctgggccgggctggggtgg
atggccaacgtgcgggcggcgcttagcgccatgtgggagcagcccaacgactccgacggg
ttcgtgcggggcaagctgtcagatctggtggcattgggctcgacgttcgtggcgctggcc
ctcaccatcgcggtcaccgttgtcggtaatgagaaaacgatcctgcgaatactcggctgg
gtggggctacatgacgtctccataccggcggtacttctcaaggtcgtcaccatcgccata
gcgaccgtgttgtcgtgggcgttgttcacctggatgatctcgcgactaccgagagagcgg
ctgccattctccagtgcggtgcgggccgggctcatcgcggcgatcggcttcgagctgttc
aaacaggtcgcgtcgatctatctgagcgtgatcatgcatggtcctgcgggctccacgttc
ggcccggtgctcggcatcatggtgttcgcctacatcaccgcccgtctgctgttgtatgcc
accgcgtgggcggccacctccgatgagaaccagccctttgtgtatgtgccgccgcccgag
ccggttgtcatcactacgcggatcgagaccgtcgagcggccctcgaagctgggtgtcctc
gccgccttcggcgctggagctcttggtgccctgggtatttcgtggctaggccgcggcgga
gactag

DBGET integrated database retrieval system