KEGG   Mycobacterium stephanolepidis: MSTE_03886Help
Entry
MSTE_03886        CDS       T05257                                 

Definition
(GenBank) glutamate decarboxylase
  KO
K01580  glutamate decarboxylase [EC:4.1.1.15]
Organism
mste  Mycobacterium stephanolepidis
Pathway
mste00250  Alanine, aspartate and glutamate metabolism
mste00410  beta-Alanine metabolism
mste00430  Taurine and hypotaurine metabolism
mste00650  Butanoate metabolism
mste01100  Metabolic pathways
mste01110  Biosynthesis of secondary metabolites
mste01120  Microbial metabolism in diverse environments
mste02024  Quorum sensing
Module
mste_M00027  GABA (gamma-Aminobutyrate) shunt
Brite
KEGG Orthology (KO) [BR:mste00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00650 Butanoate metabolism
    MSTE_03886
  09105 Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    MSTE_03886
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    MSTE_03886
   00430 Taurine and hypotaurine metabolism
    MSTE_03886
 09140 Cellular Processes
  09145 Cellular community - prokaryotes
   02024 Quorum sensing
    MSTE_03886
Enzymes [BR:mste01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.15  glutamate decarboxylase
     MSTE_03886
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pyridoxal_deC
Motif
Other DBs
NCBI-ProteinID: BAX99184
UniProt: A0A1Z4F1Y4
LinkDB All DBs
Position
complement(3851184..3852602)
Genome map
AA seq 472 aa AA seqDB search
MSNPRDQFSLSAHAGKINASSFSPAYTGRLSTAPIPALRLPDEPMDPQAAYRFIHDELML
DGSSRLNLATFVTTWMDPEAEKLMAETFDKNMIDKDEYPATAAIESRCVAMVADLFHADD
LSAEDPSSAIGVSTIGSSEAVMLAGLALKWRWRAKIGDGWKGRTPNLVMGSNVQVVWEKF
CRYFDVEPRYLPMAKDRYVITPEQVLDAVDEDTIGVVGILGTTFTGELEPIAEICAALDT
LAAMPGKPDVPVHVDAASGGFVVPFLHPELRWDFRLLRVVSINVSGHKYGLTYPGIGFVV
WRSKEHLPEDLVFRVNYLGGDMPTFTLNFSRPGNQVVGQYYNFLRLGRAGYAQVMRCLSE
TARWFGDELNKSEHFEVITDGSAIPVVSFRLKGDRPYTEFDISHSLRAFGWQVPAYTMPE
DVTDVAVLRVVVREGFSGDLARALRDDLITVLKGLDELKPNGHFDAVQPFAH
NT seq 1419 nt NT seq  +upstreamnt  +downstreamnt
atgtcgaatccccgcgatcagttcagcctttcggcgcacgccggaaagatcaacgcctcg
tcctttagccccgcctataccggccggttgtcgaccgcgcccatcccggccttacgcctc
cccgatgagccgatggatccgcaggccgcctaccggttcattcacgacgaactgatgctc
gacggcagttcgcggctgaacctcgccaccttcgtcacgacctggatggatcccgaggcc
gagaagctgatggccgagacgttcgacaagaacatgatcgacaaggacgagtacccggcg
accgcagcgatcgagtcgcggtgcgtggccatggtggccgatctgttccacgccgatgat
ctatccgccgaggacccgtcatcggcgatcggggtatcgaccatcgggtccagcgaggcg
gtgatgcttgccgggctggccctcaagtggcgctggcgcgccaaaatcggtgacggctgg
aagggccgcacaccgaacctggtgatggggtccaacgtgcaggtggtgtgggagaagttc
tgccggtacttcgacgtcgagccgcggtacctgccgatggcgaaggaccggtacgtcatc
actcccgagcaggtgctcgatgcggtggacgaggacaccatcggggtggtgggcatcctg
ggcaccaccttcaccggtgagctggagccgattgccgagatctgcgcggcgctggacact
ttggcggccatgcccggcaagccggatgtcccggtacacgtagacgccgccagcggcggt
ttcgtggtgccgttcctgcaccccgaactgcgctgggacttccggctgctccgggtggtg
tcgatcaacgtcagcgggcacaagtacggcctgacctatcccggaatcggcttcgtggtg
tggcgcagcaaggaacacctgcccgaagatctggtgttccgggtcaactatctcggcgga
gatatgccgacgttcaccctgaacttctcccgcccgggtaatcaggtggtcgggcagtac
tacaacttcctgcggttggggcgggccggttacgcacaggtgatgcgctgtttgtcggag
accgcccgctggttcggcgacgagctgaacaagagcgagcacttcgaggtgatcaccgac
ggctcggcgatcccggtggtgtcgttccggctcaagggcgaccgcccgtataccgagttc
gacatctcgcattctttgcgggcctttggctggcaggtgccggcctacacgatgcccgag
gacgtcaccgatgtcgcggtgctgcgggtggtggtacgcgaaggcttctcgggtgatctt
gcccgtgcgctgcgcgatgacctcatcaccgtgttgaaggggcttgacgagctgaaaccg
aacgggcacttcgacgcggtgcagccgttcgcgcactga

DBGET integrated database retrieval system