KEGG   Mycobacterium stephanolepidis: MSTE_04586Help
Entry
MSTE_04586        CDS       T05257                                 

Definition
(GenBank) putative aminotransferase
  KO
K00823  4-aminobutyrate aminotransferase [EC:2.6.1.19]
Organism
mste  Mycobacterium stephanolepidis
Pathway
mste00250  Alanine, aspartate and glutamate metabolism
mste00410  beta-Alanine metabolism
mste00640  Propanoate metabolism
mste00650  Butanoate metabolism
mste01100  Metabolic pathways
mste01120  Microbial metabolism in diverse environments
Module
mste_M00027  GABA (gamma-Aminobutyrate) shunt
Brite
KEGG Orthology (KO) [BR:mste00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00640 Propanoate metabolism
    MSTE_04586
   00650 Butanoate metabolism
    MSTE_04586
  09105 Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    MSTE_04586
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    MSTE_04586
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:mste01007]
    MSTE_04586
Enzymes [BR:mste01000]
 2. Transferases
  2.6  Transferring nitrogenous groups
   2.6.1  Transaminases
    2.6.1.19  4-aminobutyrate---2-oxoglutarate transaminase
     MSTE_04586
Amino acid related enzymes [BR:mste01007]
 Aminotransferase (transaminase)
  Class III
   MSTE_04586
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aminotran_3 Aminotran_1_2 DUF982
Motif
Other DBs
NCBI-ProteinID: BAX99878
UniProt: A0A1Z4F3T7
LinkDB All DBs
Position
complement(4546479..4547723)
Genome map
AA seq 414 aa AA seqDB search
MTALSPVLKQATSVVAVRGQGCYLYDESDREYLDFTAGIGVVSTGHCHPRVVEAAQRQVA
TLIHGQYTTVMHRPLQNLVRRLGDVLPADLDSLFFANSGSEAIEASVRLARQATGRPNIV
VFQGGFHGRTLAAATMTTSGPRFSSGIGPLMAGVYTAPFPTAYRYGWSETEATRFALQEL
DYLFATATAPNQVAALVIEPVLGEGGYVPANTEFLNGVAERARQHGILLVVDEVQTGFGR
TGEYFGHQHFGVAPDILVMAKGIASGFPISGIAASAELMGRAWPGSQGGTYGANAVACAA
ALATLDVIDEERLVENARARGRELLDGARKIAAERGIDGDVRGLGLMVGAEFSADGRPAA
QLAARAQALAAEKGLLLLMCGPHMNVVRMIPPLVVTADQISDALGIWNTVLAEL
NT seq 1245 nt NT seq  +upstreamnt  +downstreamnt
gtgactgcgttatcgcccgtgctcaagcaggccacctcggtggtggcggtgcgaggccag
ggttgctatctgtacgacgaaagcgaccgtgaatacctggatttcactgcgggtatcggt
gttgtgagtacgggtcactgccatccgcgtgtggtcgaggccgcgcaacggcaggtggcc
acgctgattcacggccagtacaccacggtgatgcatcgaccgttgcagaatctggtgcgc
cgtcttggtgatgtgctgcccgccgatctggattcgttgttcttcgccaactcgggcagt
gaggccatcgaggcctccgtgcggttggcgcggcaggccaccggccgcccgaatatcgtt
gtcttccagggtggatttcacggacgtaccctggccgctgccaccatgaccacctcgggc
ccacgattctcgtcgggaatcggccccttgatggccggcgtgtacacggctcctttcccg
acggcgtatcggtatggctggagcgagaccgaggccacccggttcgcactgcaggagctg
gactacctgttcgccaccgcgacggcacccaatcaggtggcggcgctggtcatcgagccg
gtgttgggcgagggcggctacgttcccgccaacaccgaattcctcaacggcgtcgccgaa
cgcgctcgtcaacacggcatcctgttggtggttgacgaggtgcagaccggatttggccgt
accggagagtatttcggccatcagcactttggtgtggcgccagatattctggtgatggct
aagggaatcgccagcgggttccccatctcgggtatcgcggcctctgccgagttgatgggg
cgtgcctggcccggttcgcagggcggtacgtatggcgccaatgccgtcgcctgtgcggct
gcgcttgcgaccctcgacgtgatcgacgaggaacggctcgtcgagaacgctcgggcgcgg
ggccgggaacttctcgacggtgcgcgaaagattgctgccgagagagggattgacggtgac
gtgcgtggtctcggattgatggtaggtgcggagttcagtgcggacggccgacctgcggcc
cagctcgccgcccgggcccaggcattggcggccgagaaggggctgctcctgctgatgtgc
ggtccgcatatgaatgtggtgcggatgattccaccattggtagtgacggccgatcagata
tccgatgccctgggcatctggaacaccgtgttggcggagctgtga

DBGET integrated database retrieval system