KEGG   Mannheimia succiniciproducens: MS0202Help
Entry
MS0202            CDS       T00201                                 

Definition
(GenBank) unknown
  KO
K01805  xylose isomerase [EC:5.3.1.5]
Organism
msu  Mannheimia succiniciproducens
Pathway
msu00040  Pentose and glucuronate interconversions
msu00051  Fructose and mannose metabolism
msu01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:msu00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    MS0202
   00051 Fructose and mannose metabolism
    MS0202
Enzymes [BR:msu01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.5  xylose isomerase
     MS0202
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AP_endonuc_2
Motif
Other DBs
NCBI-ProteinID: AAU36809
UniProt: Q65W51
LinkDB All DBs
Position
complement(176489..177472)
Genome map
AA seq 327 aa AA seqDB search
MEKLRFATRLNSFASKAHSYWPSIKGKPTIRQMIERASKVKGLTDVDLNYPQHLNEAPKE
LGKFITDCGLNVNGMAMRYSTNPEFQLGAFTHPDEKVRREAIELTKRGIDCGRELGTNLM
TIWLGQDGFDYSFQADYNKIWDDLIYAFREVAEYAPDCDISIEYKPNEPRSFSILPDVST
TLLAISDIGAKNIGVTLDFAHVLYADEMPAFAAAMIARRTKIMGLHLNDGYHKRDDGLMV
ASANPKATLELIWQLRKAGFDGAYYFDTFPDASGLDPVHECEVNIQTVNQLVKIADQLNS
VDQLNVAIANQDAVSSQGIINQFLLGR
NT seq 984 nt NT seq  +upstreamnt  +downstreamnt
atggaaaaattacgctttgctacacgtttaaattctttcgcatcaaaagcacatagttat
tggccttccattaaagggaaacctactattcgtcaaatgattgagagagcgtcaaaagtt
aaagggttaacggatgtcgatttaaattatcctcagcatttaaatgaagcaccgaaagaa
ttaggtaaatttattacagactgcggattaaacgtgaacggaatggctatgcgttatagc
accaatccggaattccagttaggtgcatttactcatcctgatgaaaaagttcgtcgtgaa
gctattgagcttactaaacgcggtattgattgcggtcgtgaacttggtaccaatttaatg
acaatctggctgggacaggatggttttgattatagtttccaggctgattacaacaaaata
tgggatgatttaatttatgcgttccgtgaagttgccgagtatgccccggattgtgatatc
agtattgagtataaacctaacgaaccccgctcctttagtattcttcccgacgtatcgacc
acattactcgctatttcggatatcggtgccaaaaatataggtgtgactcttgattttgcc
catgtgttatatgcggatgaaatgcctgctttcgccgcggcgatgattgcgcgacgaaca
aaaatcatgggattacatcttaatgacggctatcacaaacgtgatgacggtttaatggtt
gcgtcagcaaatcctaaggcgacgttagaacttatttggcaactacgtaaagcgggtttt
gacggagcctattatttcgacacattcccggatgccagcggtttagatccggtacatgaa
tgtgaagtcaatatacaaacggttaatcaattagtgaaaattgcagaccaacttaattcg
gttgatcaattgaatgttgccatcgcaaaccaagatgcagtgagtagccaagggattatt
aatcaatttttactcggaagataa

DBGET integrated database retrieval system