KEGG   Mannheimia succiniciproducens: MS0243
Entry
MS0243            CDS       T00201                                 

Gene name
rfaL
Definition
(GenBank) RfaL protein
  KO
K02847  O-antigen ligase [EC:2.4.1.-]
Organism
msu  Mannheimia succiniciproducens
Pathway
msu00540  Lipopolysaccharide biosynthesis
msu01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:msu00001]
 09100 Metabolism
  09107 Glycan biosynthesis and metabolism
   00540 Lipopolysaccharide biosynthesis
    MS0243 (rfaL)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01005 Lipopolysaccharide biosynthesis proteins [BR:msu01005]
    MS0243 (rfaL)
Enzymes [BR:msu01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.-  
     MS0243 (rfaL)
Lipopolysaccharide biosynthesis proteins [BR:msu01005]
 Core region
  MS0243 (rfaL)
SSDB
Motif
Pfam: Wzy_C
Other DBs
NCBI-ProteinID: AAU36850
UniProt: Q65W10
LinkDB
Position
complement(220666..221925)
AA seq 419 aa
MLKLNKGFLINGVVGLFFIICLSVRSGYSISPILLALVGLGYLIYDLIKKRKWQISPDEK
WLIYSYGLYFSLFVLSLLIHQGRLKELDSPVKIVFLLTLLLLFSRFPIKFSTLIYAIPMG
SMIAGITALIDRFYLHSQMAYAPRIMHIQGGDIAMSLGMFSLVCCIYFFIKQQKKWMLFC
LLATLSGMLGSILSTARGGWIGVPFVLCFIFWAYRKYLSRTFFVSVISILVVAVGVAVSI
PNTKIMKRINAAQHDITSYVDNKKGSDSTSVGARFEMWKSAFLMIKEKPVFGWGIEGVNQ
MRKEHQKQGIISKYASQFTHAHNQYLDDFSKRGVLGFIALLAVFLVPMRFFRKNLSDRLE
VKVVAIFGMVHVISVMFYCFSQGFFSHNSGNIFYFFPVILFYAVILNLTAKKSAESTKS
NT seq 1260 nt   +upstreamnt  +downstreamnt
atgttaaaactaaataaaggatttttaataaatggagttgtagggctgttctttattatc
tgtttgtcagtacgtagcggatatagcatttcccctattcttcttgctcttgtagggctg
ggctaccttatttatgatttaatcaaaaagcgaaaatggcaaatatcaccggatgaaaaa
tggctgatatacagttacgggctgtatttttcgttatttgtgctgtctttattgattcat
cagggacgtttaaaagaattggacagccctgtaaaaattgtttttttacttaccttattg
cttctctttagccgtttcccgattaaattttctacccttatttatgcgattccgatgggt
agtatgattgcgggaattaccgcattaatcgaccgtttttatctgcattctcaaatggcg
tatgccccgcgtattatgcatattcaaggcggcgatattgctatgtcgctgggcatgttt
tcattggtttgttgtatttatttctttattaaacaacagaaaaaatggatgttgttctgt
ttgctcgctacattatccggtatgctgggcagtatcctgtccaccgcccggggcggttgg
ataggtgtacctttcgtgctgtgttttattttctgggcgtatagaaaatatctgtctaga
accttttttgtttccgttatttcaattcttgttgtggctgttggcgttgcggtatccatt
cccaatacaaaaattatgaagagaattaatgcggcgcaacacgatataacaagctatgtc
gacaataaaaaaggttccgattcgacttccgtcggggcacgttttgaaatgtggaaaagt
gcgttccttatgattaaagaaaaacccgttttcggttggggaattgaaggcgttaaccaa
atgcggaaggaacaccagaaacaaggcattatcagcaaatatgcctcacaatttacccat
gcccataaccaatatttagatgatttttctaaacggggtgttctcggatttatcgcctta
cttgccgtatttttagtaccaatgcggtttttccggaagaatttatctgaccggttggaa
gtgaaagtggttgccatattcggtatggttcacgtgatttccgtgatgttttattgcttc
agccaaggatttttcagccataactcgggcaatattttttactttttcccggtgatttta
ttttatgcggtgattttgaacttaacggctaaaaaatcagcagaatcaaccaaatcataa

DBGET integrated database retrieval system