KEGG   Mannheimia succiniciproducens: MS1764Help
Entry
MS1764            CDS       T00201                                 

Gene name
tdk
Definition
(GenBank) Tdk protein
  KO
K00857  thymidine kinase [EC:2.7.1.21]
Organism
msu  Mannheimia succiniciproducens
Pathway
msu00240  Pyrimidine metabolism
msu01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:msu00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00240 Pyrimidine metabolism
    MS1764 (tdk)
Enzymes [BR:msu01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.21  thymidine kinase
     MS1764 (tdk)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: TK AAA_22 AAA_14 DUF2075 CobA_CobO_BtuR
Motif
Other DBs
NCBI-ProteinID: AAU38371
UniProt: Q65RN9
LinkDB All DBs
Position
1758363..1758950
Genome map
AA seq 195 aa AA seqDB search
MAKLYFYYSTMNAGKSTTLLQSAYNYNERNMNTLVYTAAIDDRFGAGRVTSRIGISQQAK
LFNRESNLFEEIKRHLASEKLHCILIDEAQFLTKQQVYQLSDVVDLLNIPVLCYGLRTDF
QAELFEGSQYLLAWADQLEELKTICHCGRKANFVLRLNERGDVVKDGEQIQIGGNERYLS
VCRFHFKQKTGKLHN
NT seq 588 nt NT seq  +upstreamnt  +downstreamnt
atggcaaaactttatttttactattcaacaatgaatgcagggaaatccactaccctgctg
caatctgcctataactataacgaacgcaatatgaacaccttggtttataccgcggcgatt
gacgatcgctttggcgccggcagggtaacatcccgcatcggcattagccaacaagctaaa
ttattcaatagagaaagcaatctatttgaagaaataaaaaggcatttagcttcggaaaaa
ctccattgcatcctcattgacgaagcgcagtttctgaccaaacaacaggtttatcagcta
agtgatgtagttgacctattgaatatccctgtgctttgttatggcttgcgtacggatttt
caggctgaattatttgaaggaagccaatatttgttagcctgggcggatcaattggaagaa
ctgaaaaccatttgccattgcggtcgcaaagcgaactttgtgctgcgtttaaacgagcgg
ggcgatgtggtcaaagacggcgagcaaatccaaatcggcggcaatgagcgctatttatcg
gtatgccgtttccatttcaaacaaaaaacgggcaaactgcataattaa

DBGET integrated database retrieval system