KEGG   Mannheimia succiniciproducens: MS1993Help
Entry
MS1993            CDS       T00201                                 

Gene name
glpA
Definition
(GenBank) GlpA protein
  KO
K00111  glycerol-3-phosphate dehydrogenase [EC:1.1.5.3]
Organism
msu  Mannheimia succiniciproducens
Pathway
msu00564  Glycerophospholipid metabolism
msu01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:msu00001]
 Metabolism
  Lipid metabolism
   00564 Glycerophospholipid metabolism
    MS1993 (glpA)
Enzymes [BR:msu01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.5  With a quinone or similar compound as acceptor
    1.1.5.3  glycerol-3-phosphate dehydrogenase
     MS1993 (glpA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DAO Fer2_BFD FAD_binding_2 DAO_C FAD_binding_3 Thi4 FAD_oxidored NAD_binding_8 GMC_oxred_N Pyr_redox_2 HI0933_like Pyr_redox_3
Motif
Other DBs
NCBI-ProteinID: AAU38600
UniProt: Q65R10
LinkDB All DBs
Position
1965084..1966826
Genome map
AA seq 580 aa AA seqDB search
MLGCVFYLTTNQFTFTRGGIMGMSSQLYKNVGDFSPINTDVIIIGGGATGAGVARDCSLR
GLKCVLLERHDIATGATGRNHGLLHSGGRYAVNDRESAEECIKENLILKRIARHCVDDTK
GLFITLPEDDLDYQKKFIEACQASGIEAEAIDPALAKFMEPSVNPDLVGAVVVPDGSIDP
FRLTAANMIDAVENGAQVFTYCEVKGLIREGGRVIGVNVYDHKNKINRQFFAPMVVNAGG
IWGQGIAEYADLKIRMFPAKGALLVMGHRINGMVINRCRKPADADILVPGDTICVIGTTS
DRIPYDQIDNMEVTPEEVDILIREGEKLAPSLRHTRVLRAYAGVRPLVATDDDPSGRNVS
RGIILLDHAQRDGLDGFITITGGKLMTYRLMAEWATDLVCQKLNNSKKCETSDRTLPGSN
ESREETSQKVVSLPTTIRNSAVYRHGSRATRLLENERLDRSLVCECEAVTAGEVRYAVDE
LNVNNLIDLRRRTRVGMGTCQAELCACRAAGLMARFDVATPRQSTEQLASFMEERWKGIR
PIAWGDAVREAEFTSWIYYSLLGLNDVLPEDAQGVNNNEF
NT seq 1743 nt NT seq  +upstreamnt  +downstreamnt
atgttgggttgcgtattttatttaacaaccaatcaatttactttcactcgtgggggcatt
atgggaatgtcatctcaactttataaaaatgttggtgatttttcacctattaatactgat
gtgattattatcgggggcggtgccaccggtgccggtgtggctcgagattgttcattacgc
ggtttgaaatgcgtattgttagagcgtcatgatattgcgaccggtgcgacgggccgtaat
cacggcttgctccacagcggcggtcgttatgcagtcaatgatcgtgaatccgccgaagaa
tgtatcaaagaaaatcttattttaaaacgtattgcccgtcattgtgtggatgacacgaaa
ggcttatttatcactctgccggaagatgatcttgactatcagaaaaaatttatcgaggct
tgtcaggcatccggcattgaagcggaagccattgatccggctttagcaaaatttatggaa
ccttccgtgaatccggatttagtcggcgcggtagtagttcccgacggttctatcgacccg
tttcgtttaaccgcagccaatatgattgatgcggttgaaaacggcgctcaggttttcact
tactgcgaagtaaaaggcttaatccgtgagggcggacgcgttatcggggtcaatgtttac
gatcataaaaataaaatcaaccgtcagttctttgcgccgatggtggtcaatgccggcggg
atctggggtcagggtatcgcagaatacgcggatttaaaaattcgtatgttcccggcaaaa
ggggcgttattagtcatggggcaccgtatcaacggcatggttattaaccgctgtcgtaaa
cctgcggatgcggatattctggtacccggcgatacgatttgtgtaataggtaccacatcc
gaccgcattccttacgatcagatcgataacatggaagtaacgccggaagaagtggatatt
cttatccgcgagggggaaaaattagcaccgagcctgcgtcatacccgcgtacttcgcgcc
tatgcgggggtaagaccgttagtggcgacggatgatgacccgtccggtcgtaatgtaagc
cgaggtatcatattgctggatcacgcacaacgtgacggtttggatggttttattaccatt
accggcggtaaattaatgacttatcgtttaatggctgaatgggcgacggatttagtctgt
caaaaactcaataacagcaaaaaatgcgaaacgtccgaccgtactttaccgggttctaac
gaaagccgtgaagaaaccagccaaaaagtggtttctctaccgactacgattcgtaactcc
gccgtttatcgccatggttcgcgcgctacccgtttattggaaaacgaacgtttagatcgt
tctttagtctgtgaatgcgaagcggttaccgcaggcgaagtgcgttatgcggttgatgaa
cttaacgtcaacaatcttattgacttacgccgtcgcacccgtgtgggaatgggaacctgc
caggcggaactttgcgcctgtcgtgccgccggtttaatggcgcgttttgacgtggcgaca
cctcgtcagtcaacggaacaattagcctcatttatggaagaacgctggaaaggcattcgc
cctattgcctggggcgatgcggtgcgtgaagccgaattcacaagctggatttattacagc
ctgcttggtttaaatgatgtattaccagaagatgcgcaaggagtgaataacaatgaattt
tga

DBGET integrated database retrieval system