KEGG   Methanobacterium subterraneum: BK009_06810Help
Entry
BK009_06810       CDS       T05275                                 

Definition
(GenBank) CO dehydrogenase/acetyl-CoA synthase complex subunit epsilon
  KO
K00192  anaerobic carbon-monoxide dehydrogenase, CODH/ACS complex subunit alpha [EC:1.2.7.4]
Organism
msub  Methanobacterium subterraneum
Pathway
msub00680  Methane metabolism
msub01100  Metabolic pathways
msub01120  Microbial metabolism in diverse environments
msub01200  Carbon metabolism
Module
msub_M00422  Acetyl-CoA pathway, CO2 => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:msub00001]
 09100 Metabolism
  09102 Energy metabolism
   00680 Methane metabolism
    BK009_06810
Enzymes [BR:msub01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.7  With an iron-sulfur protein as acceptor
    1.2.7.4  anaerobic carbon-monoxide dehydrogenase
     BK009_06810
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Prismane Fer4_9 Fer4_7 Fer4_8 Fer4_16 Fer4_17 Fer4_22
Motif
Other DBs
NCBI-ProteinID: AUB60417
UniProt: A0A2H4VCA8
LinkDB All DBs
Position
complement(1427070..1429433)
Genome map
AA seq 787 aa AA seqDB search
MAPKPKSKPKDFKDDFWKKKDLKISIGEIVEKEGAVSAEVSEEKTPMGPTPKPHVTDLRS
WDMKLLSRYEPFYAPFCDMCCLCTFGKCDLLNKKGACGIDSATQQARIVLLACNIGTAAH
AGHARHMINHLIEELGEDYPLDLGFNIDIEAPITRTIIGQKPENLGDLKDVMGYVEEQLS
HLLSACHTGQEGNSLDFESKSLHSGVMDDLAREVGDIAQIVALNMPKGDGDAPLVEMGVG
TIDSSKPVVLCIGHNVVPGASIMDYLDETGQEEDLEVCGICCAAIDISRYNDRAKVVGPL
SRQLKFIRSGVADVIIVDEQCIRTDVLEEAQRKNTAVIATTDKMCLGLPDMTDKDPDLIV
SKLLNKEIEGALILDPEKVGEVSVKVAKILAPEREKLKLLPELEEVQKLALECTECGWCN
RVCPNNKPMMEAVVAAGTGNFSNFEELYLNDVCYSCGRCEQECERDLPLMSMLAKAGEKL
AKDEKFNIRAGRGPVQDVEIRRVGAPLVLGDIPGVIAIVGCSNYPNGGKEVAEMAKEFLE
RNYIVVATGCGAMSIGEYRDEEGKTLYEQYSGEFDSRGLLNIGSCVSNAHISGACIKIAN
IFAKKPLEGNFEEIADYILNRVGACGVAWGAYSQKAAAIATGVNRWGIPVVVGPHGSKYR
RLLLGRTDKKETWKIKDLRTGKIMDGEPAPEHLIYAAENMEEAIVMTAKLCIRPTDTGKG
RQIKLNHYIDLYKRYYGILPPDIHLFVRNEKDIPITYKKDVKEILEEVGWEPREIPQEPS
LMGMDGD
NT seq 2364 nt NT seq  +upstreamnt  +downstreamnt
gtggcacctaaaccaaagtctaaaccaaaagatttcaaggatgatttttggaaaaagaag
gatctaaaaatctccataggcgaaatagttgaaaaagagggagcagtatctgctgaagta
tccgaagaaaagactcctatggggccaactccaaaaccccacgtcacagatctaagatca
tgggacatgaaactgcttagtagatatgagccattctatgcaccattctgtgacatgtgt
tgtctttgtacattcggaaaatgtgaccttttgaacaagaaaggggcttgtgggattgat
tctgcaactcagcaagcgcgtattgttcttttagcatgtaacattggtactgcggcccat
gctggtcatgccaggcacatgatcaaccatcttattgaagaactgggtgaagattatccc
cttgatttgggctttaacatagatattgaagcccccattacccgaactataataggtcaa
aaacctgaaaatctcggtgatttgaaggatgttatgggttatgtggaggaacaattatct
catctgttatctgcctgtcacactggtcaagaaggaaatagccttgactttgaatctaaa
tcactccattcaggtgttatggatgatctggcaagggaagttggggatatagctcagatc
gtggccctgaacatgcctaaaggagatggagatgcccccctggttgagatgggtgtgggt
accattgactcttcaaaaccagttgtactgtgcataggtcataacgttgtcccaggtgcc
agtataatggattaccttgatgaaaccggtcaagaagaggatttagaggtttgcggtatc
tgttgtgcagcaattgatatttccagatacaatgaccgggctaaggtagtaggtcctttg
tctaggcagctaaaatttatccgcagtggggttgctgatgtgatcatagtggatgaacag
tgtattcggactgatgtactggaagaagcccaaaggaaaaatacagcagtaattgccacc
accgacaagatgtgtctgggtctgccagatatgactgataaggatcccgatttaattgta
tccaaattattaaacaaagagatcgaaggtgccctcatactagaccctgaaaaggtgggt
gaggtttcagttaaagttgccaagattctagcaccagaacgggaaaaactcaaattatta
ccagaactggaagaagtacaaaagttagcactggaatgtacggagtgtggctggtgtaac
cgggtttgtcccaacaacaaaccaatgatggaggcagtggtggcagcaggaaccggtaac
ttctctaattttgaagaactataccttaacgatgtatgttattcctgcggtagatgtgaa
caggaatgtgaacgggaccttcccctcatgtccatgttagccaaggcgggtgaaaaatta
gccaaggacgaaaaattcaacatccgcgctggccgaggcccagtacaagatgtggaaata
agaagagtaggtgcaccacttgtattgggagatataccgggtgtaatagccattgtggga
tgttcaaactaccctaatggtgggaaagaagttgcggagatggcaaaagaattcctggaa
agaaactacatagtggtggccactggatgcggggcaatgtccattggtgaataccgtgat
gaagaaggaaaaacactatacgaacagtacagtggtgaatttgattcccgaggattgcta
aacataggttcatgtgtgtccaacgcccatatttccggagcctgcataaagatcgccaat
atttttgctaaaaaaccattggaaggcaactttgaggagatagccgattacattctaaac
cgagttggagcttgtggtgttgcttggggtgcttactctcaaaaagcagctgcaatcgca
acgggagttaaccgatggggtataccagtagtggttggtccgcacggttcaaaatatcgc
cgattattattgggaagaactgataagaaggaaacctggaaaataaaggatctgaggact
ggtaaaataatggatggtgaacccgcaccagaacacttgatttacgcggcagaaaacatg
gaagaagccatagtaatgacagctaaactatgcatcaggccaaccgacactggcaagggg
cgtcaaatcaaattaaaccattatatcgatctttataagaggtattatggtatattgcct
ccagatattcatttatttgtccgtaatgagaaagatattcccatcacctataaaaaagat
gtgaaggaaatactggaagaagtgggatgggaacctcgtgaaatacctcaggaaccctct
ttaatgggaatggatggtgattaa

DBGET integrated database retrieval system