KEGG   Methanobacterium subterraneum: BK009_09065
Entry
BK009_09065       CDS       T05275                                 

Definition
(GenBank) hypothetical protein
  KO
K18853  dihydromethanopterin reductase (acceptor) [EC:1.5.99.15]
Organism
msub  Methanobacterium subterraneum
Pathway
msub00790  Folate biosynthesis
Brite
KEGG Orthology (KO) [BR:msub00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    BK009_09065
Enzymes [BR:msub01000]
 1. Oxidoreductases
  1.5  Acting on the CH-NH group of donors
   1.5.99  With unknown physiological acceptors
    1.5.99.15  dihydromethanopterin reductase (acceptor)
     BK009_09065
SSDB
Motif
Pfam: Flavoprotein Fer4 Fer4_8 Fer4_6 Fer4_16 Fer4_7 Fer4_10 Fer4_17 Fer4_2 Fer4_9 Fer4_4 Fer4_21 Fer4_3 Fer4_15
Other DBs
NCBI-ProteinID: AUB60811
UniProt: A0A2H4VRT6
LinkDB
Position
1864389..1865081
AA seq 230 aa
MKIAWAFTGAGHLLRESVETLEKLATEHKVTVLLSGAGEEVLKMYGLFDRVKSVTGGYYQ
ELILEKDQMWSYPISGRFSLGRYDLLIVSPTTSNTIAKLVHGIADSLVTNAVAQSGKGKV
KTLLVPVDLESGDLDTVLPSKLELDLCQNCTTCEAAAVCPPDAITPGVEINLLKCQGCAA
CQTACPYGAVSGGSIITIHMREIDIKNSRKLHHLEGVEVLKDPLEILSHL
NT seq 693 nt   +upstreamnt  +downstreamnt
atgaaaattgcctgggccttcaccggagcaggtcatctgctcagagaaagcgtggaaaca
ctggaaaaacttgcaacagaacataaggtaactgtactgctttctggtgctggtgaagaa
gttttaaaaatgtacggactcttcgaccgtgttaaatcagttaccggaggatattatcag
gagctgattttggaaaaggaccaaatgtggagttatcccatatctggtcgtttttccctg
gggagatacgatttattaattgtttcccccaccacctccaacaccattgccaaactggtt
catggaattgctgacagcctggtgaccaatgccgtggcccaatccggtaaagggaaagta
aaaaccctgctggtcccagttgaccttgaatctggagatttagatacggttctcccctct
aaactcgaactggacctatgccagaactgtactacttgtgaggctgcagcagtatgccct
cccgatgccatcacccctggagtggagatcaacctccttaaatgccagggatgtgctgcc
tgccaaacggcatgcccctacggtgcagtgagcggaggtagcattatcaccatccacatg
cgggaaattgacattaaaaacagcaggaaacttcatcatctggagggagtggaagtttta
aaggacccattagaaatattaagccatctataa

DBGET integrated database retrieval system