KEGG   Methanobacterium subterraneum: BK009_11270Help
Entry
BK009_11270       CDS       T05275                                 

Definition
(GenBank) aquaporin
  KO
K02440  glycerol uptake facilitator protein
Organism
msub  Methanobacterium subterraneum
Brite
KEGG Orthology (KO) [BR:msub00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:msub02000]
    BK009_11270
Transporters [BR:msub02000]
 Other transporters
  Aquaporins and small neutral solute transporters [TC:1.A.8]
   Aquaglyceroporins or glycerol-uptake facilitators
    BK009_11270
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: MIP
Motif
Other DBs
NCBI-ProteinID: AUB61197
UniProt: A0A2H4VSZ3
LinkDB All DBs
Position
complement(2330987..2331739)
Genome map
AA seq 250 aa AA seqDB search
MVSLMKRSVAELIGTFILVFFGTGAAIVTLMISKGQTPPNSFNIGIGALGGLGDWLAIGL
AFGLAIAACIYGFGKISGCHINPAVTIALWSVKKFPSRDVAPYVVAQLIGAALASFTLAY
IIGMGAVTTGGLGATAPFEGIGYFQAILAETIGTFILMLAIMGVAVDREAPPGFAGLIIG
LTVAGAITTLGNITGGSLNPARTFGPYLGDMVLGGTNLWANFPIYIIGPIVGAVLAALVY
TYLSEETRTA
NT seq 753 nt NT seq  +upstreamnt  +downstreamnt
atggtttctttaatgaaaagatcagtagccgaacttattgggacatttattctcgtattt
tttggtactggtgctgcaatcgttaccctgatgatcagtaaaggtcaaacacctcctaac
tctttcaatatagggataggtgcattggggggtcttggagactggttagcaataggtttg
gctttcggacttgctatagctgcatgtatctatggatttggtaaaatatctggttgccat
atcaacccggcagtaaccatagctctgtggtcggtgaaaaaattcccatcacgggatgtt
gcaccctacgtggttgctcaacttattggagccgccctagctagtttcaccttagcctac
ataattggaatgggggcagtaaccactggaggcttaggtgccaccgcaccatttgaaggt
ataggttacttccaagctattctagcagaaacaatagggacattcatactcatgctggcc
ataatgggagtagctgtggacagggaagctccacctggatttgctggcctgataattggg
ttaaccgttgccggtgcaataaccaccctgggtaacataaccggaggatcactaaaccct
gccaggactttcggcccttacctaggagacatggtattaggaggaaccaatctctgggcc
aacttccccatctatatcataggccctattgtaggagcggttctagctgcattagtatat
acctatctttcagaagaaacaagaacagcttga

DBGET integrated database retrieval system