KEGG   Meiothermus silvanus: Mesil_0661Help
Entry
Mesil_0661        CDS       T01246                                 

Definition
(GenBank) D-alanine/D-alanine ligase
  KO
K01921  D-alanine-D-alanine ligase [EC:6.3.2.4]
Organism
msv  Meiothermus silvanus
Pathway
msv00473  D-Alanine metabolism
msv00550  Peptidoglycan biosynthesis
msv01100  Metabolic pathways
msv01502  Vancomycin resistance
Brite
KEGG Orthology (KO) [BR:msv00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00473 D-Alanine metabolism
    Mesil_0661
  09107 Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    Mesil_0661
 09160 Human Diseases
  09175 Drug resistance: antimicrobial
   01502 Vancomycin resistance
    Mesil_0661
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:msv01011]
    Mesil_0661
Enzymes [BR:msv01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.4  D-alanine---D-alanine ligase
     Mesil_0661
Peptidoglycan biosynthesis and degradation proteins [BR:msv01011]
 Precursor biosynthesis
  Amino acid ligase
   Mesil_0661
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Dala_Dala_lig_C Dala_Dala_lig_N ATP-grasp CPSase_L_D2 ATP-grasp_3 ATP-grasp_4 RimK
Motif
Other DBs
NCBI-ProteinID: ADH62578
UniProt: D7BAQ6
LinkDB All DBs
Position
complement(646277..647251)
Genome map
AA seq 324 aa AA seqDB search
MSNLRVLLIAGGRSGEHEVSLSSARGVLAAMPHPTDLAVIAKDGKWLLGQAAQRALHTGS
AEEGEHAFPPPIEWRAYAVAFPLLHGTLGEDGTIQGFFEILGLPYVGAGVTASALCMDKD
LCKRVLAQAGIPVVPWVSFYRGDPVPPLPFPAPYFVKPANTGSSVGVSKVKTDQDGREAL
EEAFRWDRKVVIEQGLEGVRELEIALLGNIYAEPSVIGEISYQSEFYDYQTKYTEGLAHM
RIPARIPAELEKRIRELAVAAYRVLGVRGMARVDFFLSQDGTLYLNELNTIPGFTPTSMY
PKLWQASGMRYPELLDRLVRLALS
NT seq 975 nt NT seq  +upstreamnt  +downstreamnt
atgagtaatttgcgtgttttactcattgccgggggacggtcaggagagcacgaagtttcc
ctctcctcagcccggggggtgctggcggccatgcctcaccctaccgacctggcggtgatc
gccaaggacggaaagtggctgctgggccaagccgcccagcgagctttgcacacgggcagc
gccgaggagggcgaacatgccttcccaccgccgattgaatggcgggcttatgccgtagct
tttccgcttctgcacggaacgctgggcgaagacgggaccatccaggggtttttcgagatc
ctcgggctgccctacgtgggcgcaggggtaacggcctccgccttgtgcatggacaaggac
ctctgcaagcgggtgctggcccaggccgggatcccggtagtaccgtgggtgagcttttac
cgaggcgatcccgtaccccctctccccttcccggccccttacttcgttaagccggcgaac
accggttcctcggtcggagtaagcaaagtaaaaaccgaccaagatggcagggaggccctc
gaggaggccttccgctgggaccgtaaggtggtcatcgaacaggggctcgagggggtgcgc
gagttggaaatcgcccttttgggaaacatctacgccgagccgagcgtgattggcgagatc
agctaccaaagcgagttctacgactaccagaccaagtacaccgagggtctggcccatatg
cgcatcccggcccgaatccccgccgaactcgaaaagcgcatccgcgagctggcagtcgca
gcctaccgggtgctgggggtgcgggggatggcccgtgtggacttctttctgagccaagac
ggaacgctctatctgaacgaactcaacaccatccccggcttcacccccaccagtatgtat
cccaagctgtggcaggcctcggggatgcgctacccggagcttttggaccgcttggtgcgg
ctggcgctctcctaa

DBGET integrated database retrieval system