KEGG   Meiothermus silvanus: Mesil_1134Help
Entry
Mesil_1134        CDS       T01246                                 

Definition
(GenBank) catalytic domain of components of various dehydrogenase complexes
  KO
K00627  pyruvate dehydrogenase E2 component (dihydrolipoamide acetyltransferase) [EC:2.3.1.12]
Organism
msv  Meiothermus silvanus
Pathway
msv00010  Glycolysis / Gluconeogenesis
msv00020  Citrate cycle (TCA cycle)
msv00620  Pyruvate metabolism
msv01100  Metabolic pathways
msv01110  Biosynthesis of secondary metabolites
msv01120  Microbial metabolism in diverse environments
msv01130  Biosynthesis of antibiotics
msv01200  Carbon metabolism
Module
msv_M00307  Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:msv00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Mesil_1134
   00020 Citrate cycle (TCA cycle)
    Mesil_1134
   00620 Pyruvate metabolism
    Mesil_1134
Enzymes [BR:msv01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.12  dihydrolipoyllysine-residue acetyltransferase
     Mesil_1134
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 2-oxoacid_dh Biotin_lipoyl E3_binding
Motif
Other DBs
NCBI-ProteinID: ADH63038
UniProt: D7BDC0
LinkDB All DBs
Position
complement(1125355..1126785)
Genome map
AA seq 476 aa AA seqDB search
MPKEIILPELAESVVEGEILKWLVAEGDELKKDQPFVEVMTDKVTVELPSPYAGVLVKKL
VNEGDIVKVHAPIALIAEPGEVAGAISDRNTEPTPAPSIQAQEERSIVEPGNVNEDSGEE
LSLFKPDKKPEQVKNPFTQATLRGVAVAEPPRAATNPYGRVIAVPAARKLARELGLDIAQ
IPGSGPGGRVRVEDVRSYAEHQGSRVEAAPQPTPVAPAPVQAPAPAGFPAPVQYKPPKGY
EGLEERVPLRGLRRAIANQMVASHLYTVRTLSVDEADLTELVELRSRLKPEAEKQGVKLS
YLPFIFKALARALKKFPSLNSSMDEARQEIVLKKYYNIGMAVATDAGLVVPVIKDVDRKS
VLELAAEVGELAEKARAGKLTPEDMVGSTFSVTNIGSIGALFSFPIINVPDAAILGVHSI
QKRPVVMDNDEIKVRHMMYLSLSFDHRLVDGAEAAMFCKEVIRLLERPDLLMLEAI
NT seq 1431 nt NT seq  +upstreamnt  +downstreamnt
atgcccaaggagatcattctgcctgagctagccgaatcggtagtcgagggcgagattctc
aagtggctcgtcgccgagggtgacgagctaaaaaaggatcagcccttcgtcgaggtcatg
accgataaagtcacggtggagttacccagcccctatgcgggcgtattggtgaaaaagctg
gtaaatgagggcgacatcgtcaaggtgcatgcccccatcgccttgattgccgagcccggc
gaggtagccggggctatcagcgatcgcaacaccgagcccaccccggctccctctattcaa
gcccaagaagagcgctcgatcgtggaaccggggaacgtaaacgaggactcgggcgaggag
ctttcgctattcaagccagataagaagccggagcaggtgaaaaatcccttcacccaggcc
actttgcgcggggttgccgtagccgagccaccgcgggccgccaccaacccctatggccgg
gtgatcgccgtgcccgccgcgcgaaaactggcccgcgagctgggcctggacatcgcccag
atccccggctccggcccaggtggccgcgtgcgggtggaagacgtgaggagctacgccgag
catcaagggtcacgggtcgaggctgccccccagcccactcccgtggccccagcacctgtg
caggcccctgctcctgcaggattccccgctcccgtgcagtataagccgcccaaaggctac
gaggggctcgaggagcgcgtccccctgcgcgggctgcgccgggccatcgctaaccagatg
gtggcctcgcacctctacacggtgcgcaccttgagcgtggacgaagccgacctgaccgag
ctggtggagctacgctcgaggctcaaacccgaggccgagaaacagggcgtaaagctcagc
tatctgcccttcatcttcaaagccctcgcccgtgcgctcaagaagttccccagcctcaac
tcctcgatggacgaggcccgccaggagatcgtcctgaagaagtactacaacatcggcatg
gccgtcgccaccgacgccgggctggtggtgccggtcatcaaggatgtcgaccgcaagagc
gtgctcgagctcgccgccgaggtgggcgagctagccgagaaggccagagccggtaagctc
accccggaagacatggtgggctcgaccttctccgtcaccaacatcggctccatcggcgcg
ctcttcagcttccctatcatcaacgtgcccgacgccgccatcttgggcgtgcactccatc
cagaagcgtccggtggtgatggataacgacgagatcaaggtgcggcacatgatgtacctc
tcgctctccttcgaccatcgcctggtggacggggccgaagcagcgatgttttgtaaggaa
gtgatccggctcctcgagcgccccgacttgctgatgcttgaggcgatttag

DBGET integrated database retrieval system